Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EB63

Protein Details
Accession A0A5J5EB63    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
137-165YSYPDKPALKACRRRKRVRPLPDNAKPMRHydrophilic
NLS Segment(s)
PositionSequence
149-156RRRKRVRP
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPENSDKLRPQSSLWLSPSPPPELSLSEPPLPEPSLPEPPLPEPLRSQLPLWPSPSPPSELSLPKPPLPELSLPEPPLPGPPLPGQALKNPYFMGVYQAKMPGHTESKPPKAFMDTQQALFPDDAGRDDPNIIQPLYSYPDKPALKACRRRKRVRPLPDNAKPMRLPSRMASLLKTEEREAEQRKVQAEEEAVNPQQSKENSDRTKRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.43
4 0.47
5 0.49
6 0.43
7 0.37
8 0.31
9 0.3
10 0.28
11 0.32
12 0.33
13 0.34
14 0.33
15 0.33
16 0.32
17 0.33
18 0.3
19 0.25
20 0.23
21 0.23
22 0.28
23 0.29
24 0.29
25 0.3
26 0.3
27 0.38
28 0.36
29 0.33
30 0.27
31 0.3
32 0.34
33 0.32
34 0.31
35 0.26
36 0.3
37 0.31
38 0.32
39 0.3
40 0.27
41 0.3
42 0.3
43 0.31
44 0.26
45 0.26
46 0.26
47 0.28
48 0.3
49 0.35
50 0.36
51 0.35
52 0.35
53 0.33
54 0.3
55 0.3
56 0.28
57 0.24
58 0.25
59 0.27
60 0.27
61 0.27
62 0.25
63 0.22
64 0.21
65 0.19
66 0.14
67 0.13
68 0.13
69 0.15
70 0.16
71 0.19
72 0.18
73 0.21
74 0.26
75 0.25
76 0.25
77 0.22
78 0.21
79 0.19
80 0.17
81 0.18
82 0.14
83 0.13
84 0.13
85 0.16
86 0.15
87 0.15
88 0.16
89 0.13
90 0.14
91 0.15
92 0.21
93 0.24
94 0.32
95 0.33
96 0.32
97 0.31
98 0.32
99 0.33
100 0.3
101 0.34
102 0.28
103 0.28
104 0.28
105 0.28
106 0.25
107 0.23
108 0.19
109 0.09
110 0.08
111 0.08
112 0.09
113 0.09
114 0.08
115 0.09
116 0.09
117 0.11
118 0.13
119 0.12
120 0.1
121 0.1
122 0.11
123 0.15
124 0.16
125 0.14
126 0.14
127 0.23
128 0.23
129 0.24
130 0.3
131 0.36
132 0.44
133 0.54
134 0.63
135 0.66
136 0.75
137 0.84
138 0.86
139 0.88
140 0.89
141 0.89
142 0.88
143 0.88
144 0.89
145 0.88
146 0.86
147 0.77
148 0.72
149 0.62
150 0.57
151 0.55
152 0.47
153 0.41
154 0.35
155 0.41
156 0.4
157 0.4
158 0.36
159 0.32
160 0.35
161 0.36
162 0.35
163 0.29
164 0.27
165 0.29
166 0.35
167 0.37
168 0.37
169 0.39
170 0.4
171 0.41
172 0.41
173 0.38
174 0.34
175 0.31
176 0.28
177 0.25
178 0.27
179 0.26
180 0.26
181 0.26
182 0.23
183 0.28
184 0.26
185 0.3
186 0.31
187 0.41
188 0.47
189 0.56