Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F431

Protein Details
Accession A0A5J5F431    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MNRGRDRDRGRDRRQPPQRRDGRSDRDHDBasic
38-68REPREPREPRDRGKRRSSRSRSPDRRGDNRDBasic
NLS Segment(s)
PositionSequence
5-110RDRDRGRDRRQPPQRRDGRSDRDHDPRREPREPREPREPREPRDRGKRRSSRSRSPDRRGDNRDYRTRDRGPYPTRGGRGDRGKGGRDRPPPPPPPPRRRSPIPKV
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MNRGRDRDRGRDRRQPPQRRDGRSDRDHDPRREPREPREPREPREPRDRGKRRSSRSRSPDRRGDNRDYRTRDRGPYPTRGGRGDRGKGGRDRPPPPPPPPRRRSPIPKVEVKAKTEEMALDVGPEDEESQMAALMGFGSFGTTKQKKVRGNDVGAVAKNKTAQYRQYMNRPGGFNRALSPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.83
4 0.83
5 0.84
6 0.82
7 0.85
8 0.84
9 0.83
10 0.8
11 0.77
12 0.73
13 0.75
14 0.75
15 0.72
16 0.72
17 0.72
18 0.72
19 0.75
20 0.74
21 0.72
22 0.74
23 0.77
24 0.74
25 0.75
26 0.74
27 0.71
28 0.77
29 0.76
30 0.71
31 0.73
32 0.73
33 0.7
34 0.74
35 0.78
36 0.75
37 0.79
38 0.82
39 0.8
40 0.85
41 0.84
42 0.84
43 0.84
44 0.87
45 0.86
46 0.84
47 0.84
48 0.81
49 0.82
50 0.78
51 0.78
52 0.75
53 0.73
54 0.73
55 0.71
56 0.69
57 0.67
58 0.64
59 0.59
60 0.54
61 0.56
62 0.52
63 0.52
64 0.52
65 0.5
66 0.48
67 0.46
68 0.44
69 0.42
70 0.44
71 0.39
72 0.38
73 0.36
74 0.36
75 0.37
76 0.39
77 0.4
78 0.41
79 0.42
80 0.43
81 0.49
82 0.51
83 0.54
84 0.61
85 0.63
86 0.67
87 0.69
88 0.7
89 0.69
90 0.72
91 0.74
92 0.73
93 0.73
94 0.69
95 0.7
96 0.66
97 0.68
98 0.64
99 0.56
100 0.51
101 0.42
102 0.36
103 0.29
104 0.27
105 0.18
106 0.15
107 0.12
108 0.08
109 0.07
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.05
129 0.15
130 0.16
131 0.22
132 0.29
133 0.37
134 0.43
135 0.49
136 0.59
137 0.58
138 0.61
139 0.6
140 0.59
141 0.56
142 0.52
143 0.48
144 0.38
145 0.32
146 0.3
147 0.28
148 0.28
149 0.28
150 0.32
151 0.37
152 0.46
153 0.51
154 0.57
155 0.63
156 0.63
157 0.64
158 0.62
159 0.57
160 0.56
161 0.51
162 0.43