Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5F6E3

Protein Details
Accession A0A5J5F6E3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-35TASAPAKKATRYRPKPDRIFRDDSSHydrophilic
281-302RENPRAVKQRGPGKSKKRTPKABasic
NLS Segment(s)
PositionSequence
285-302RAVKQRGPGKSKKRTPKA
Subcellular Location(s) mito 10.5, cyto_mito 10.5, cyto 9.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MVIPTPTQENTASAPAKKATRYRPKPDRIFRDDSSDIFPGRGWFVGGLHRPWWRGVDSDSDSAGYIPTPPPPSPPTTSATLAASKARGSITFFHTMYPAILKTAATVKVLTENPEDPPLYVHESICHLYHFASMIKEDTIVFPTKSGLAATVVLSCCYNFGVLKDLALEEEPFSFQMEVWKLAYRIGFRKLPKVICHGISKKLTYCDIAELIEYTRIRLGLEEDLLNAGADERLPKAIEIWTKDGDTRLKDAFTMGGSPLCVLMVEYPEFGAELFHLVMDRENPRAVKQRGPGKSKKRTPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.39
5 0.44
6 0.48
7 0.55
8 0.64
9 0.71
10 0.77
11 0.84
12 0.89
13 0.91
14 0.9
15 0.87
16 0.85
17 0.76
18 0.74
19 0.66
20 0.57
21 0.52
22 0.44
23 0.36
24 0.29
25 0.28
26 0.2
27 0.19
28 0.17
29 0.13
30 0.11
31 0.11
32 0.18
33 0.21
34 0.21
35 0.24
36 0.27
37 0.28
38 0.29
39 0.31
40 0.25
41 0.24
42 0.23
43 0.27
44 0.28
45 0.29
46 0.28
47 0.25
48 0.24
49 0.22
50 0.2
51 0.12
52 0.09
53 0.08
54 0.13
55 0.16
56 0.16
57 0.21
58 0.24
59 0.29
60 0.31
61 0.34
62 0.33
63 0.33
64 0.35
65 0.32
66 0.3
67 0.27
68 0.24
69 0.22
70 0.19
71 0.15
72 0.15
73 0.14
74 0.12
75 0.13
76 0.15
77 0.19
78 0.23
79 0.23
80 0.22
81 0.22
82 0.22
83 0.2
84 0.18
85 0.13
86 0.09
87 0.09
88 0.08
89 0.09
90 0.12
91 0.13
92 0.12
93 0.12
94 0.12
95 0.16
96 0.17
97 0.19
98 0.17
99 0.17
100 0.17
101 0.2
102 0.2
103 0.15
104 0.15
105 0.15
106 0.17
107 0.17
108 0.15
109 0.14
110 0.16
111 0.17
112 0.16
113 0.14
114 0.1
115 0.09
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.09
122 0.08
123 0.09
124 0.08
125 0.08
126 0.09
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.06
136 0.06
137 0.06
138 0.08
139 0.08
140 0.08
141 0.08
142 0.07
143 0.07
144 0.06
145 0.07
146 0.05
147 0.05
148 0.09
149 0.09
150 0.09
151 0.09
152 0.09
153 0.09
154 0.09
155 0.09
156 0.05
157 0.06
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.1
164 0.11
165 0.12
166 0.13
167 0.14
168 0.13
169 0.15
170 0.17
171 0.15
172 0.18
173 0.21
174 0.26
175 0.25
176 0.32
177 0.36
178 0.38
179 0.38
180 0.41
181 0.39
182 0.37
183 0.44
184 0.4
185 0.42
186 0.41
187 0.41
188 0.37
189 0.36
190 0.34
191 0.28
192 0.25
193 0.21
194 0.19
195 0.17
196 0.14
197 0.12
198 0.12
199 0.15
200 0.14
201 0.12
202 0.12
203 0.12
204 0.12
205 0.12
206 0.13
207 0.11
208 0.12
209 0.12
210 0.11
211 0.12
212 0.12
213 0.11
214 0.08
215 0.07
216 0.05
217 0.05
218 0.06
219 0.06
220 0.08
221 0.08
222 0.08
223 0.09
224 0.14
225 0.18
226 0.21
227 0.25
228 0.26
229 0.26
230 0.27
231 0.3
232 0.3
233 0.28
234 0.28
235 0.26
236 0.24
237 0.23
238 0.23
239 0.2
240 0.17
241 0.16
242 0.12
243 0.12
244 0.11
245 0.11
246 0.11
247 0.09
248 0.08
249 0.07
250 0.07
251 0.09
252 0.1
253 0.1
254 0.1
255 0.1
256 0.1
257 0.1
258 0.09
259 0.06
260 0.07
261 0.07
262 0.07
263 0.07
264 0.08
265 0.09
266 0.14
267 0.17
268 0.18
269 0.22
270 0.23
271 0.28
272 0.38
273 0.4
274 0.43
275 0.48
276 0.55
277 0.61
278 0.68
279 0.73
280 0.74
281 0.81
282 0.84