Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VIE9

Protein Details
Accession H1VIE9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPRRKAKTNKFNKRTLKKSSAAHydrophilic
NLS Segment(s)
PositionSequence
4-15RKAKTNKFNKRT
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPRRKAKTNKFNKRTLKKSSAAATPSTTTAVQTSDTKSFVDEATPYNDDPIPLDLSSAPRGKSPDLDTQSNSTSPAPSTPSKPPTERPHLVPSQKKRFDHAMAVAKVHRAIAEVRKCRAEMKRLNDLFHHHQDSATLGLLDGGVVAASDRLAQAVEDAERTQAGNPPGYVRYPAEMIPELLASVEKAETDRYKWNSKLRRLYLLLSIISSETMPNLKRKLEAARDEMAALRTSRTVVQDRPEPPYPLDLLDGMKKRYPVLKGFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.84
4 0.77
5 0.76
6 0.72
7 0.68
8 0.61
9 0.54
10 0.48
11 0.41
12 0.37
13 0.33
14 0.27
15 0.2
16 0.18
17 0.17
18 0.16
19 0.17
20 0.2
21 0.2
22 0.21
23 0.21
24 0.2
25 0.21
26 0.18
27 0.17
28 0.15
29 0.14
30 0.19
31 0.2
32 0.2
33 0.21
34 0.21
35 0.19
36 0.19
37 0.19
38 0.16
39 0.14
40 0.15
41 0.13
42 0.16
43 0.21
44 0.22
45 0.2
46 0.2
47 0.23
48 0.23
49 0.27
50 0.28
51 0.33
52 0.35
53 0.38
54 0.38
55 0.38
56 0.39
57 0.35
58 0.32
59 0.23
60 0.19
61 0.16
62 0.16
63 0.17
64 0.18
65 0.22
66 0.27
67 0.33
68 0.37
69 0.39
70 0.46
71 0.5
72 0.57
73 0.56
74 0.53
75 0.55
76 0.57
77 0.61
78 0.62
79 0.63
80 0.65
81 0.68
82 0.64
83 0.61
84 0.6
85 0.55
86 0.5
87 0.47
88 0.45
89 0.39
90 0.39
91 0.36
92 0.31
93 0.28
94 0.24
95 0.17
96 0.09
97 0.11
98 0.17
99 0.25
100 0.28
101 0.29
102 0.31
103 0.31
104 0.35
105 0.37
106 0.38
107 0.36
108 0.39
109 0.47
110 0.47
111 0.48
112 0.44
113 0.46
114 0.43
115 0.41
116 0.37
117 0.27
118 0.25
119 0.25
120 0.24
121 0.19
122 0.13
123 0.08
124 0.05
125 0.05
126 0.05
127 0.04
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.07
148 0.07
149 0.1
150 0.12
151 0.12
152 0.12
153 0.14
154 0.15
155 0.15
156 0.17
157 0.13
158 0.13
159 0.14
160 0.14
161 0.15
162 0.14
163 0.14
164 0.13
165 0.12
166 0.1
167 0.09
168 0.08
169 0.05
170 0.05
171 0.05
172 0.04
173 0.05
174 0.09
175 0.1
176 0.13
177 0.21
178 0.25
179 0.32
180 0.37
181 0.46
182 0.52
183 0.6
184 0.67
185 0.63
186 0.66
187 0.62
188 0.59
189 0.55
190 0.49
191 0.4
192 0.3
193 0.27
194 0.19
195 0.17
196 0.15
197 0.09
198 0.07
199 0.11
200 0.13
201 0.18
202 0.21
203 0.22
204 0.23
205 0.27
206 0.34
207 0.39
208 0.44
209 0.43
210 0.43
211 0.42
212 0.41
213 0.4
214 0.33
215 0.26
216 0.2
217 0.16
218 0.14
219 0.15
220 0.17
221 0.2
222 0.23
223 0.25
224 0.31
225 0.37
226 0.4
227 0.46
228 0.48
229 0.46
230 0.43
231 0.43
232 0.39
233 0.32
234 0.31
235 0.25
236 0.23
237 0.28
238 0.31
239 0.31
240 0.32
241 0.32
242 0.33
243 0.38
244 0.41