Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EKE2

Protein Details
Accession A0A5J5EKE2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SSQHNQAKKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
13-63AKKAHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEIKEGKRE
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQAKKAHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKEIKEGKREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.78
4 0.76
5 0.76
6 0.78
7 0.81
8 0.8
9 0.76
10 0.75
11 0.75
12 0.75
13 0.72
14 0.7
15 0.68
16 0.64
17 0.63
18 0.61
19 0.57
20 0.52
21 0.51
22 0.53
23 0.48
24 0.51
25 0.55
26 0.58
27 0.64
28 0.66
29 0.73
30 0.66
31 0.72
32 0.66
33 0.66
34 0.64
35 0.58
36 0.54
37 0.49
38 0.45
39 0.4
40 0.39
41 0.32
42 0.31
43 0.36
44 0.41