Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EGZ3

Protein Details
Accession A0A5J5EGZ3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-53AEPAPAPARQRRQRKQRTKQPGGGLPHydrophilic
NLS Segment(s)
PositionSequence
35-44ARQRRQRKQR
Subcellular Location(s) cyto 6, cyto_nucl 15, nucl 20
Family & Domain DBs
Amino Acid Sequences MASPSSSSPEPERRPRPPSDISESEPEAEPAPAPARQRRQRKQRTKQPGGGLPTDVIGNAVDTVGNTVGQVGDTAGNLVGGVAGAVPGGEKKEGGKDTLRLRLDLNLEIEVTLKARIHGDLTLSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.69
4 0.67
5 0.66
6 0.64
7 0.6
8 0.56
9 0.56
10 0.51
11 0.46
12 0.39
13 0.32
14 0.24
15 0.2
16 0.16
17 0.12
18 0.13
19 0.14
20 0.17
21 0.24
22 0.33
23 0.42
24 0.53
25 0.6
26 0.7
27 0.78
28 0.85
29 0.89
30 0.9
31 0.92
32 0.9
33 0.87
34 0.83
35 0.77
36 0.7
37 0.6
38 0.5
39 0.39
40 0.3
41 0.23
42 0.16
43 0.1
44 0.06
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.04
76 0.04
77 0.05
78 0.06
79 0.12
80 0.14
81 0.17
82 0.19
83 0.24
84 0.29
85 0.37
86 0.38
87 0.33
88 0.33
89 0.34
90 0.34
91 0.31
92 0.28
93 0.2
94 0.19
95 0.18
96 0.18
97 0.14
98 0.12
99 0.12
100 0.1
101 0.11
102 0.12
103 0.13
104 0.14
105 0.14
106 0.16