Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EY31

Protein Details
Accession A0A5J5EY31   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPRGKNKARKASARKAEKNPEALNHydrophilic
NLS Segment(s)
PositionSequence
3-17RGKNKARKASARKAE
Subcellular Location(s) cyto 4, mito 5, nucl 17
Family & Domain DBs
Amino Acid Sequences MPRGKNKARKASARKAEKNPEALNDSEKTPDPVPHCPPSTEEAKSNPYTSEITPEVLRICPLRETLRNRHPGFRRCLGSGQGLPSTLVLGKPFNDFLKSCESPHLDRFLGSHRKHRELMFSVFDDEQVYVRPTMQDSLTVKMACDATNPSMPEFMHIIRWCLGIEEGQSVPVELMDRNYHDCVRENFRRLKATQMAFFVEVTMWEDEGREEWEKSVRSHVARKQKQLLAEIPMQATTNCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.88
4 0.84
5 0.82
6 0.73
7 0.69
8 0.61
9 0.54
10 0.49
11 0.4
12 0.35
13 0.3
14 0.28
15 0.27
16 0.25
17 0.28
18 0.28
19 0.34
20 0.39
21 0.43
22 0.44
23 0.41
24 0.42
25 0.41
26 0.42
27 0.38
28 0.35
29 0.32
30 0.36
31 0.37
32 0.35
33 0.31
34 0.29
35 0.28
36 0.25
37 0.26
38 0.21
39 0.21
40 0.2
41 0.21
42 0.19
43 0.17
44 0.18
45 0.13
46 0.14
47 0.14
48 0.16
49 0.2
50 0.26
51 0.33
52 0.41
53 0.49
54 0.58
55 0.58
56 0.64
57 0.67
58 0.68
59 0.67
60 0.65
61 0.59
62 0.52
63 0.52
64 0.46
65 0.42
66 0.36
67 0.32
68 0.25
69 0.22
70 0.2
71 0.17
72 0.15
73 0.11
74 0.09
75 0.08
76 0.08
77 0.08
78 0.09
79 0.11
80 0.11
81 0.13
82 0.13
83 0.14
84 0.22
85 0.22
86 0.21
87 0.24
88 0.27
89 0.27
90 0.29
91 0.31
92 0.23
93 0.22
94 0.23
95 0.25
96 0.31
97 0.3
98 0.36
99 0.37
100 0.41
101 0.43
102 0.43
103 0.41
104 0.35
105 0.37
106 0.31
107 0.27
108 0.25
109 0.23
110 0.22
111 0.17
112 0.13
113 0.1
114 0.08
115 0.09
116 0.07
117 0.07
118 0.07
119 0.07
120 0.09
121 0.08
122 0.12
123 0.13
124 0.15
125 0.17
126 0.17
127 0.16
128 0.17
129 0.17
130 0.12
131 0.12
132 0.12
133 0.12
134 0.15
135 0.16
136 0.15
137 0.16
138 0.16
139 0.16
140 0.16
141 0.14
142 0.17
143 0.17
144 0.18
145 0.17
146 0.18
147 0.16
148 0.15
149 0.15
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.1
156 0.09
157 0.08
158 0.08
159 0.08
160 0.06
161 0.08
162 0.09
163 0.11
164 0.15
165 0.17
166 0.18
167 0.19
168 0.23
169 0.26
170 0.33
171 0.38
172 0.42
173 0.47
174 0.51
175 0.55
176 0.51
177 0.55
178 0.54
179 0.51
180 0.48
181 0.43
182 0.41
183 0.36
184 0.35
185 0.27
186 0.19
187 0.15
188 0.14
189 0.12
190 0.1
191 0.09
192 0.09
193 0.09
194 0.1
195 0.14
196 0.14
197 0.14
198 0.15
199 0.21
200 0.23
201 0.24
202 0.3
203 0.33
204 0.35
205 0.43
206 0.5
207 0.56
208 0.62
209 0.69
210 0.71
211 0.68
212 0.68
213 0.65
214 0.61
215 0.56
216 0.52
217 0.46
218 0.38
219 0.35
220 0.31