Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EEJ1

Protein Details
Accession A0A5J5EEJ1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
103-127PPAPTRREQAPPKSRHKRKESGSAAHydrophilic
NLS Segment(s)
PositionSequence
109-133REQAPPKSRHKRKESGSAATNRVRR
152-170TAAARRRTAAAASAKPAGI
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSDKPPPHSFQFTSKNKATPPTAAAIDGASVTPTSPSNPLPPAYLFPGYRPDAYVPIPQELPWDMVSPPAGSEVVRILAATPTPPLPAGAFPSWLPWQGVDVPPAPTRREQAPPKSRHKRKESGSAATNRVRRPSTHPVQATKSASQDSRRTAAARRRTAAAASAKPAGIQKKSRGNQNGDSAFPDSPAERTQTHADEKNPSTPAKRPVIRTGRSRLPYHLEVAETMVVDDDTGIDDSDDSVGRFMPFNEAWAQLVREGRENERAGGGPPSGSSSNNPVALHPPAEAPPAVPPAHRPSTCKVQVMIPAGDTDIDTEIDTEIDTEIDTDIDDSDHRVDDGASSARPAVGDQAAVDDTTAGMQRRFTPAKRASSAASPLEGEKQNRFGSNQER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.59
4 0.62
5 0.57
6 0.51
7 0.47
8 0.43
9 0.39
10 0.35
11 0.32
12 0.25
13 0.21
14 0.17
15 0.13
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.13
23 0.15
24 0.2
25 0.23
26 0.24
27 0.26
28 0.27
29 0.28
30 0.3
31 0.33
32 0.28
33 0.27
34 0.33
35 0.33
36 0.32
37 0.31
38 0.27
39 0.26
40 0.29
41 0.32
42 0.27
43 0.28
44 0.28
45 0.25
46 0.26
47 0.24
48 0.23
49 0.19
50 0.18
51 0.14
52 0.16
53 0.17
54 0.14
55 0.13
56 0.12
57 0.11
58 0.09
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.1
74 0.11
75 0.16
76 0.15
77 0.16
78 0.15
79 0.19
80 0.19
81 0.2
82 0.19
83 0.14
84 0.15
85 0.18
86 0.19
87 0.18
88 0.18
89 0.2
90 0.23
91 0.26
92 0.26
93 0.24
94 0.26
95 0.28
96 0.35
97 0.4
98 0.47
99 0.55
100 0.61
101 0.7
102 0.78
103 0.83
104 0.84
105 0.85
106 0.83
107 0.79
108 0.81
109 0.76
110 0.72
111 0.71
112 0.67
113 0.64
114 0.61
115 0.6
116 0.51
117 0.5
118 0.44
119 0.39
120 0.42
121 0.46
122 0.46
123 0.49
124 0.51
125 0.51
126 0.54
127 0.58
128 0.53
129 0.45
130 0.4
131 0.35
132 0.33
133 0.33
134 0.34
135 0.3
136 0.29
137 0.28
138 0.28
139 0.32
140 0.37
141 0.42
142 0.43
143 0.41
144 0.41
145 0.4
146 0.39
147 0.38
148 0.35
149 0.27
150 0.24
151 0.24
152 0.21
153 0.21
154 0.24
155 0.22
156 0.21
157 0.23
158 0.27
159 0.35
160 0.38
161 0.45
162 0.49
163 0.51
164 0.51
165 0.55
166 0.5
167 0.41
168 0.4
169 0.34
170 0.27
171 0.23
172 0.18
173 0.11
174 0.11
175 0.11
176 0.12
177 0.1
178 0.13
179 0.15
180 0.18
181 0.21
182 0.22
183 0.23
184 0.27
185 0.28
186 0.3
187 0.29
188 0.27
189 0.26
190 0.28
191 0.33
192 0.34
193 0.36
194 0.35
195 0.43
196 0.51
197 0.53
198 0.54
199 0.54
200 0.54
201 0.55
202 0.53
203 0.46
204 0.44
205 0.4
206 0.37
207 0.32
208 0.24
209 0.2
210 0.19
211 0.17
212 0.11
213 0.09
214 0.07
215 0.05
216 0.05
217 0.05
218 0.03
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.05
226 0.06
227 0.05
228 0.05
229 0.06
230 0.06
231 0.07
232 0.07
233 0.11
234 0.11
235 0.12
236 0.14
237 0.14
238 0.14
239 0.15
240 0.15
241 0.13
242 0.15
243 0.14
244 0.17
245 0.19
246 0.2
247 0.26
248 0.27
249 0.25
250 0.24
251 0.24
252 0.2
253 0.2
254 0.18
255 0.11
256 0.1
257 0.13
258 0.13
259 0.13
260 0.13
261 0.17
262 0.2
263 0.23
264 0.23
265 0.2
266 0.23
267 0.24
268 0.23
269 0.18
270 0.16
271 0.14
272 0.16
273 0.15
274 0.12
275 0.13
276 0.17
277 0.16
278 0.15
279 0.18
280 0.24
281 0.32
282 0.33
283 0.34
284 0.35
285 0.45
286 0.5
287 0.48
288 0.42
289 0.38
290 0.42
291 0.43
292 0.38
293 0.28
294 0.24
295 0.22
296 0.21
297 0.17
298 0.12
299 0.08
300 0.08
301 0.08
302 0.08
303 0.08
304 0.07
305 0.07
306 0.07
307 0.06
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.05
315 0.05
316 0.06
317 0.06
318 0.08
319 0.09
320 0.1
321 0.1
322 0.1
323 0.1
324 0.1
325 0.13
326 0.13
327 0.12
328 0.13
329 0.13
330 0.13
331 0.13
332 0.13
333 0.13
334 0.12
335 0.12
336 0.11
337 0.13
338 0.13
339 0.13
340 0.12
341 0.08
342 0.08
343 0.09
344 0.12
345 0.11
346 0.12
347 0.14
348 0.17
349 0.26
350 0.32
351 0.33
352 0.4
353 0.47
354 0.55
355 0.56
356 0.56
357 0.5
358 0.51
359 0.55
360 0.46
361 0.4
362 0.33
363 0.31
364 0.36
365 0.38
366 0.35
367 0.34
368 0.38
369 0.4
370 0.41
371 0.42