Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EZ97

Protein Details
Accession A0A5J5EZ97   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-130AEYFEKRSRWKDRNKVLKRAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 7, cyto 11, cyto_mito 7.333, cyto_nucl 7.833, nucl 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040201  Mrg3-like  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Amino Acid Sequences TGTAIGAGAYTVYLYNELVEKPLSIYPSEAAAQIKRALYYASRGEVGDMANAFKQAIQIAEQSGMHPLSDEVAGLKIECAQLLLKAKDGQYAAKAVAILEHVLDEAYAGAEYFEKRSRWKDRNKVLKRAVLLGYKIGEMYQGLGKDDKAEEAMSWATETLLKEMKRREESKKREEENDEDWFDSIATSACFEKLAQHYERTAQYYLATPLYLKAVSLLPPKTCHAITLMNNIATTLSRQQLPEGAESGKVTRAHLLDNAQKWAEKALEMNAVVKPSVRTEECDQACVAATYNLGEIARMLGDKKTAEGRLNEALSLAKRLGLEEGIEAAKEGLEQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.1
5 0.12
6 0.12
7 0.12
8 0.13
9 0.16
10 0.16
11 0.15
12 0.16
13 0.15
14 0.18
15 0.18
16 0.18
17 0.18
18 0.18
19 0.2
20 0.22
21 0.23
22 0.2
23 0.2
24 0.19
25 0.18
26 0.22
27 0.23
28 0.22
29 0.22
30 0.22
31 0.22
32 0.22
33 0.21
34 0.18
35 0.14
36 0.14
37 0.13
38 0.13
39 0.12
40 0.11
41 0.11
42 0.09
43 0.1
44 0.1
45 0.11
46 0.12
47 0.13
48 0.13
49 0.13
50 0.15
51 0.14
52 0.12
53 0.11
54 0.1
55 0.1
56 0.09
57 0.09
58 0.06
59 0.07
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.11
69 0.17
70 0.17
71 0.18
72 0.21
73 0.21
74 0.24
75 0.25
76 0.23
77 0.18
78 0.2
79 0.17
80 0.15
81 0.15
82 0.11
83 0.11
84 0.1
85 0.08
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.08
100 0.12
101 0.13
102 0.17
103 0.25
104 0.34
105 0.42
106 0.52
107 0.6
108 0.66
109 0.77
110 0.81
111 0.83
112 0.79
113 0.74
114 0.65
115 0.6
116 0.53
117 0.45
118 0.38
119 0.29
120 0.24
121 0.2
122 0.18
123 0.13
124 0.1
125 0.07
126 0.07
127 0.08
128 0.07
129 0.08
130 0.08
131 0.08
132 0.1
133 0.1
134 0.09
135 0.08
136 0.08
137 0.07
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.05
144 0.07
145 0.07
146 0.08
147 0.12
148 0.13
149 0.16
150 0.19
151 0.26
152 0.3
153 0.34
154 0.42
155 0.48
156 0.56
157 0.62
158 0.68
159 0.65
160 0.64
161 0.64
162 0.59
163 0.53
164 0.5
165 0.41
166 0.32
167 0.3
168 0.24
169 0.2
170 0.15
171 0.1
172 0.06
173 0.05
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.1
180 0.12
181 0.17
182 0.18
183 0.19
184 0.2
185 0.23
186 0.25
187 0.24
188 0.22
189 0.18
190 0.17
191 0.17
192 0.18
193 0.15
194 0.13
195 0.1
196 0.1
197 0.11
198 0.1
199 0.08
200 0.08
201 0.08
202 0.11
203 0.16
204 0.18
205 0.18
206 0.2
207 0.22
208 0.23
209 0.22
210 0.2
211 0.18
212 0.22
213 0.22
214 0.27
215 0.28
216 0.25
217 0.25
218 0.25
219 0.22
220 0.16
221 0.16
222 0.13
223 0.12
224 0.14
225 0.14
226 0.15
227 0.18
228 0.2
229 0.19
230 0.18
231 0.17
232 0.16
233 0.16
234 0.17
235 0.18
236 0.17
237 0.16
238 0.18
239 0.18
240 0.19
241 0.21
242 0.25
243 0.27
244 0.28
245 0.31
246 0.28
247 0.27
248 0.26
249 0.26
250 0.22
251 0.15
252 0.14
253 0.14
254 0.17
255 0.17
256 0.19
257 0.18
258 0.18
259 0.17
260 0.17
261 0.16
262 0.14
263 0.19
264 0.18
265 0.22
266 0.26
267 0.36
268 0.35
269 0.36
270 0.34
271 0.28
272 0.28
273 0.23
274 0.19
275 0.11
276 0.1
277 0.09
278 0.09
279 0.1
280 0.09
281 0.09
282 0.08
283 0.08
284 0.08
285 0.08
286 0.09
287 0.09
288 0.12
289 0.12
290 0.15
291 0.2
292 0.23
293 0.27
294 0.28
295 0.32
296 0.36
297 0.37
298 0.34
299 0.29
300 0.29
301 0.25
302 0.26
303 0.21
304 0.16
305 0.16
306 0.16
307 0.18
308 0.15
309 0.15
310 0.13
311 0.16
312 0.14
313 0.13
314 0.13
315 0.11
316 0.1