Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EY79

Protein Details
Accession A0A5J5EY79   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-56QYNPTPCPSRCKKTKAKTKATGSGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5, cyto_mito 5, mito 5, nucl 16
Family & Domain DBs
Amino Acid Sequences MTTPKLEHKPSAPHSSHKRSRSPSSDPDDDEQYNPTPCPSRCKKTKAKTKATGSGTAADPIDLTGDDDSDSESNDEAAPALLPPATAANPGNPTTGAPPATPSEEELWLRCNFPRRRSNTMSGILWTTFWPTSPVADKFGRIRVGRSCYYDEAENFVRDLDELAKPVPGALGRADFGRASLRTRLREAGICQPIVRVLEERRLGFFRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.74
4 0.72
5 0.74
6 0.72
7 0.78
8 0.76
9 0.74
10 0.73
11 0.72
12 0.71
13 0.65
14 0.61
15 0.58
16 0.52
17 0.45
18 0.39
19 0.33
20 0.29
21 0.25
22 0.24
23 0.25
24 0.24
25 0.33
26 0.38
27 0.45
28 0.52
29 0.61
30 0.69
31 0.73
32 0.83
33 0.84
34 0.86
35 0.86
36 0.85
37 0.85
38 0.78
39 0.73
40 0.64
41 0.57
42 0.47
43 0.39
44 0.31
45 0.22
46 0.17
47 0.12
48 0.11
49 0.07
50 0.07
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.07
75 0.08
76 0.11
77 0.12
78 0.12
79 0.11
80 0.11
81 0.11
82 0.13
83 0.12
84 0.1
85 0.11
86 0.11
87 0.13
88 0.12
89 0.12
90 0.12
91 0.13
92 0.13
93 0.12
94 0.14
95 0.14
96 0.14
97 0.15
98 0.22
99 0.25
100 0.33
101 0.41
102 0.44
103 0.51
104 0.56
105 0.6
106 0.57
107 0.56
108 0.49
109 0.41
110 0.36
111 0.28
112 0.23
113 0.17
114 0.14
115 0.1
116 0.1
117 0.11
118 0.1
119 0.11
120 0.16
121 0.17
122 0.19
123 0.2
124 0.22
125 0.22
126 0.26
127 0.3
128 0.26
129 0.28
130 0.29
131 0.34
132 0.35
133 0.37
134 0.36
135 0.32
136 0.34
137 0.34
138 0.28
139 0.28
140 0.27
141 0.24
142 0.2
143 0.18
144 0.16
145 0.13
146 0.14
147 0.11
148 0.1
149 0.11
150 0.11
151 0.11
152 0.11
153 0.11
154 0.11
155 0.09
156 0.09
157 0.1
158 0.11
159 0.11
160 0.12
161 0.13
162 0.12
163 0.12
164 0.16
165 0.16
166 0.18
167 0.25
168 0.31
169 0.33
170 0.37
171 0.4
172 0.38
173 0.42
174 0.42
175 0.44
176 0.44
177 0.41
178 0.37
179 0.34
180 0.34
181 0.3
182 0.28
183 0.23
184 0.21
185 0.29
186 0.34
187 0.34
188 0.36