Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5FBF6

Protein Details
Accession A0A5J5FBF6   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
174-196ETSPVKTPKKKTATKAKKGGEDCHydrophilic
NLS Segment(s)
PositionSequence
181-191PKKKTATKAKK
Subcellular Location(s) cyto 10.5, cyto_nucl 10, mito 9, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MSDSPIKQGDEVSWKWGSGNPSGTVAEIKTSGKLEIETAGKKVHKNSDAENPAVHVAREGNDVVKRASELTKENGAASTEEPKTEGQETKKVEEKEKGEEKGEEKGEEKPGEKEGEKEDREMKEASQSEKGTATTLTGSKRERVETPLAEEAEKPMEEKKVEEEVADKVAEAIETSPVKTPKKKTATKAKKGGEDCPATYTDTPATRTRSKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.29
4 0.28
5 0.25
6 0.28
7 0.24
8 0.26
9 0.26
10 0.26
11 0.24
12 0.21
13 0.17
14 0.15
15 0.14
16 0.14
17 0.15
18 0.15
19 0.14
20 0.14
21 0.13
22 0.15
23 0.19
24 0.18
25 0.19
26 0.23
27 0.25
28 0.27
29 0.32
30 0.36
31 0.37
32 0.38
33 0.4
34 0.46
35 0.47
36 0.45
37 0.4
38 0.33
39 0.31
40 0.28
41 0.24
42 0.15
43 0.12
44 0.12
45 0.14
46 0.12
47 0.13
48 0.14
49 0.16
50 0.15
51 0.15
52 0.14
53 0.14
54 0.15
55 0.15
56 0.16
57 0.18
58 0.21
59 0.21
60 0.21
61 0.2
62 0.19
63 0.17
64 0.15
65 0.17
66 0.14
67 0.14
68 0.15
69 0.14
70 0.15
71 0.17
72 0.2
73 0.17
74 0.23
75 0.26
76 0.27
77 0.34
78 0.33
79 0.34
80 0.36
81 0.35
82 0.37
83 0.4
84 0.38
85 0.34
86 0.34
87 0.32
88 0.32
89 0.31
90 0.24
91 0.19
92 0.2
93 0.23
94 0.22
95 0.22
96 0.17
97 0.19
98 0.2
99 0.2
100 0.19
101 0.19
102 0.26
103 0.26
104 0.26
105 0.29
106 0.27
107 0.3
108 0.28
109 0.24
110 0.23
111 0.24
112 0.25
113 0.25
114 0.24
115 0.23
116 0.24
117 0.24
118 0.17
119 0.15
120 0.13
121 0.1
122 0.12
123 0.13
124 0.16
125 0.17
126 0.21
127 0.23
128 0.25
129 0.25
130 0.27
131 0.31
132 0.28
133 0.32
134 0.32
135 0.31
136 0.29
137 0.27
138 0.24
139 0.2
140 0.19
141 0.15
142 0.13
143 0.15
144 0.15
145 0.16
146 0.19
147 0.21
148 0.21
149 0.21
150 0.2
151 0.19
152 0.2
153 0.19
154 0.15
155 0.1
156 0.1
157 0.1
158 0.08
159 0.07
160 0.1
161 0.11
162 0.12
163 0.17
164 0.22
165 0.28
166 0.35
167 0.41
168 0.46
169 0.56
170 0.63
171 0.67
172 0.74
173 0.8
174 0.83
175 0.86
176 0.83
177 0.82
178 0.77
179 0.74
180 0.71
181 0.65
182 0.56
183 0.49
184 0.43
185 0.38
186 0.35
187 0.32
188 0.28
189 0.26
190 0.29
191 0.31
192 0.37
193 0.38