Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W2P0

Protein Details
Accession H1W2P0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29TGSVWQQQQQRAREKKKKRETETEWHVSFHydrophilic
NLS Segment(s)
PositionSequence
13-19REKKKKR
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 9, cyto 6
Family & Domain DBs
Amino Acid Sequences TGSVWQQQQQRAREKKKKRETETEWHVSFQGSWVSRRFQGWGGGRPDELDVMFGAVQAYTASVQTEYERRPSNPLFQLDRDARGVCRAHSQVHPLECSPTKAYLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.89
4 0.92
5 0.89
6 0.9
7 0.86
8 0.87
9 0.85
10 0.83
11 0.73
12 0.63
13 0.55
14 0.44
15 0.36
16 0.27
17 0.23
18 0.16
19 0.17
20 0.18
21 0.2
22 0.22
23 0.22
24 0.23
25 0.19
26 0.25
27 0.26
28 0.31
29 0.32
30 0.31
31 0.3
32 0.29
33 0.27
34 0.2
35 0.16
36 0.1
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.03
45 0.04
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.1
53 0.11
54 0.16
55 0.19
56 0.2
57 0.26
58 0.28
59 0.34
60 0.36
61 0.4
62 0.39
63 0.38
64 0.44
65 0.4
66 0.41
67 0.36
68 0.31
69 0.26
70 0.28
71 0.28
72 0.21
73 0.27
74 0.26
75 0.28
76 0.3
77 0.35
78 0.35
79 0.38
80 0.4
81 0.33
82 0.38
83 0.36
84 0.38
85 0.35
86 0.32