Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5ERZ1

Protein Details
Accession A0A5J5ERZ1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
243-263ELPPLKKKRGRPTKAEMEARRBasic
NLS Segment(s)
PositionSequence
162-187GRKRGNASAAASAATPIKRKRGRPSK
247-263LKKKRGRPTKAEMEARR
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MLSQLRTAVVPPTTSSITRPPRPPPPPSQSHHGSQLSPLAPAPVQHPHLVNGHTNGALTNWTSINNQDPYTPNSDAMPTGPPWTDAEKISLLVEILRDCEVVAPNWRNITIPPGRTSLQAQQIFAMLTASPENSPATSPAAPVAAPPPPPPPQPQPQPAASGRKRGNASAAASAATPIKRKRGRPSKADMALREQLSQSGAPAAATWQPQMYTPDHGRGGVSMLATPAGATPSLGAIQQQLSELPPLKKKRGRPTKAEMEARRERQRLELLAAQRIHGGDLPSDIQDLDDQARQKHEQDQAQQQMRDQENERTNDSGNAHEEVEEDESEEGGPDSPDTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.31
4 0.39
5 0.46
6 0.5
7 0.53
8 0.61
9 0.67
10 0.72
11 0.72
12 0.71
13 0.72
14 0.71
15 0.72
16 0.66
17 0.64
18 0.65
19 0.58
20 0.5
21 0.43
22 0.45
23 0.37
24 0.33
25 0.29
26 0.22
27 0.19
28 0.19
29 0.21
30 0.2
31 0.22
32 0.24
33 0.25
34 0.26
35 0.29
36 0.31
37 0.31
38 0.27
39 0.26
40 0.23
41 0.22
42 0.19
43 0.16
44 0.15
45 0.12
46 0.12
47 0.1
48 0.11
49 0.12
50 0.14
51 0.19
52 0.21
53 0.21
54 0.22
55 0.24
56 0.26
57 0.32
58 0.31
59 0.26
60 0.24
61 0.24
62 0.21
63 0.2
64 0.19
65 0.14
66 0.15
67 0.15
68 0.15
69 0.16
70 0.19
71 0.2
72 0.18
73 0.2
74 0.18
75 0.18
76 0.17
77 0.15
78 0.12
79 0.1
80 0.1
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.09
87 0.1
88 0.1
89 0.17
90 0.18
91 0.2
92 0.21
93 0.21
94 0.2
95 0.19
96 0.25
97 0.23
98 0.23
99 0.24
100 0.26
101 0.27
102 0.28
103 0.31
104 0.29
105 0.33
106 0.32
107 0.3
108 0.27
109 0.27
110 0.25
111 0.22
112 0.17
113 0.07
114 0.06
115 0.06
116 0.07
117 0.06
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.11
124 0.1
125 0.11
126 0.1
127 0.1
128 0.1
129 0.1
130 0.1
131 0.09
132 0.1
133 0.11
134 0.15
135 0.17
136 0.19
137 0.24
138 0.28
139 0.33
140 0.39
141 0.43
142 0.42
143 0.41
144 0.44
145 0.43
146 0.47
147 0.42
148 0.43
149 0.4
150 0.41
151 0.41
152 0.36
153 0.35
154 0.28
155 0.28
156 0.21
157 0.2
158 0.14
159 0.13
160 0.13
161 0.12
162 0.1
163 0.12
164 0.12
165 0.21
166 0.26
167 0.31
168 0.41
169 0.5
170 0.56
171 0.6
172 0.66
173 0.66
174 0.68
175 0.68
176 0.58
177 0.53
178 0.51
179 0.45
180 0.38
181 0.28
182 0.22
183 0.19
184 0.18
185 0.12
186 0.08
187 0.07
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.09
194 0.09
195 0.09
196 0.1
197 0.14
198 0.14
199 0.17
200 0.18
201 0.21
202 0.21
203 0.21
204 0.2
205 0.17
206 0.17
207 0.13
208 0.12
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.05
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.07
226 0.08
227 0.07
228 0.08
229 0.11
230 0.15
231 0.17
232 0.25
233 0.3
234 0.39
235 0.44
236 0.52
237 0.61
238 0.68
239 0.71
240 0.72
241 0.76
242 0.77
243 0.81
244 0.81
245 0.75
246 0.73
247 0.75
248 0.74
249 0.73
250 0.65
251 0.57
252 0.53
253 0.54
254 0.48
255 0.43
256 0.41
257 0.36
258 0.4
259 0.39
260 0.34
261 0.3
262 0.28
263 0.24
264 0.2
265 0.18
266 0.11
267 0.13
268 0.14
269 0.12
270 0.13
271 0.12
272 0.1
273 0.1
274 0.11
275 0.12
276 0.14
277 0.16
278 0.18
279 0.23
280 0.25
281 0.27
282 0.32
283 0.37
284 0.4
285 0.46
286 0.54
287 0.59
288 0.64
289 0.62
290 0.58
291 0.59
292 0.55
293 0.53
294 0.46
295 0.46
296 0.46
297 0.48
298 0.49
299 0.42
300 0.41
301 0.4
302 0.38
303 0.33
304 0.29
305 0.27
306 0.25
307 0.23
308 0.22
309 0.19
310 0.2
311 0.16
312 0.14
313 0.12
314 0.12
315 0.12
316 0.12
317 0.1
318 0.08
319 0.09
320 0.08