Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EDL9

Protein Details
Accession A0A5J5EDL9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
208-231ELEARPNKKGKKQAKRRNETFYYHHydrophilic
NLS Segment(s)
PositionSequence
212-224RPNKKGKKQAKRR
Subcellular Location(s) cyto 8.5, cyto_nucl 13, nucl 16.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MSSNKRKDPINDDGDGDINMSSAADNGDDSGSEDMDMVKVDFEMFDPQPAHDFHGIRQLLRQLFDADSALFDLSALTELILSQPLLGTTVKTEGNESDPFAFLTVINLHEHASNLAIQTLASYLLAKSASSPQLHAKLRSLLDSGSSAQLGLILTERLINMPVQVVPPMYKMLLEEIEWALAENEPYNFTHFMVLSKTYTEVASRLDELEARPNKKGKKQAKRRNETFYYHPEDEVIWRRCGEDNAAGFRFEKEGEAADSKRAFSDMGIKPQGLMMLIEKEGFGQMVEDLEGLFKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.36
3 0.29
4 0.19
5 0.13
6 0.1
7 0.08
8 0.06
9 0.05
10 0.06
11 0.05
12 0.05
13 0.06
14 0.07
15 0.07
16 0.08
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.09
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.12
31 0.12
32 0.16
33 0.16
34 0.17
35 0.2
36 0.2
37 0.23
38 0.23
39 0.24
40 0.21
41 0.3
42 0.3
43 0.27
44 0.3
45 0.32
46 0.29
47 0.29
48 0.29
49 0.22
50 0.22
51 0.23
52 0.2
53 0.14
54 0.12
55 0.11
56 0.1
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.05
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.09
77 0.1
78 0.1
79 0.12
80 0.11
81 0.15
82 0.16
83 0.16
84 0.15
85 0.14
86 0.14
87 0.13
88 0.13
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.08
99 0.08
100 0.07
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.05
114 0.06
115 0.1
116 0.13
117 0.13
118 0.15
119 0.17
120 0.25
121 0.27
122 0.27
123 0.25
124 0.26
125 0.26
126 0.26
127 0.23
128 0.15
129 0.14
130 0.14
131 0.13
132 0.09
133 0.09
134 0.07
135 0.06
136 0.07
137 0.06
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.08
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.08
162 0.09
163 0.08
164 0.08
165 0.08
166 0.08
167 0.07
168 0.06
169 0.06
170 0.05
171 0.05
172 0.07
173 0.07
174 0.1
175 0.1
176 0.1
177 0.12
178 0.11
179 0.12
180 0.12
181 0.14
182 0.12
183 0.12
184 0.12
185 0.11
186 0.12
187 0.11
188 0.1
189 0.11
190 0.12
191 0.12
192 0.11
193 0.11
194 0.12
195 0.12
196 0.21
197 0.25
198 0.26
199 0.3
200 0.35
201 0.41
202 0.47
203 0.56
204 0.57
205 0.62
206 0.71
207 0.78
208 0.83
209 0.88
210 0.88
211 0.87
212 0.83
213 0.76
214 0.72
215 0.69
216 0.67
217 0.57
218 0.5
219 0.41
220 0.36
221 0.37
222 0.4
223 0.35
224 0.28
225 0.27
226 0.29
227 0.3
228 0.31
229 0.29
230 0.27
231 0.27
232 0.31
233 0.32
234 0.31
235 0.3
236 0.29
237 0.26
238 0.2
239 0.17
240 0.12
241 0.13
242 0.16
243 0.2
244 0.2
245 0.24
246 0.25
247 0.24
248 0.24
249 0.23
250 0.19
251 0.15
252 0.24
253 0.24
254 0.31
255 0.34
256 0.33
257 0.32
258 0.33
259 0.33
260 0.23
261 0.19
262 0.13
263 0.13
264 0.14
265 0.14
266 0.13
267 0.13
268 0.13
269 0.12
270 0.09
271 0.07
272 0.07
273 0.07
274 0.08
275 0.07
276 0.07