Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KKZ5

Protein Details
Accession A0A5N6KKZ5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-72AWVGWKSRRARIKRKSSNEASSPHydrophilic
NLS Segment(s)
PositionSequence
56-64SRRARIKRK
Subcellular Location(s) plas 16, mito 4, E.R. 4, nucl 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQYAEQEKQLTSMPPGDNAFVGSLPQDDIIQIIFGVIATVLGTLSVVLAWVGWKSRRARIKRKSSNEASSPGTFEIRLIVASANATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.23
5 0.21
6 0.2
7 0.18
8 0.12
9 0.11
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.05
16 0.06
17 0.06
18 0.05
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.03
39 0.05
40 0.06
41 0.12
42 0.15
43 0.22
44 0.31
45 0.4
46 0.5
47 0.59
48 0.69
49 0.75
50 0.81
51 0.84
52 0.83
53 0.82
54 0.75
55 0.69
56 0.63
57 0.53
58 0.47
59 0.39
60 0.32
61 0.24
62 0.2
63 0.17
64 0.13
65 0.12
66 0.1
67 0.09
68 0.09