Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KLB3

Protein Details
Accession A0A5N6KLB3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-138NINSQNSKKERKKERKKERKKKRTSIIPGHTPSBasic
NLS Segment(s)
PositionSequence
113-128KKERKKERKKERKKKR
Subcellular Location(s) cysk 12, nucl 7, cyto_nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MEIREMEGIVLYCSAIWIFDAQGDRIEGENIRARYVPPAPRTTHQPKITNNATPFPITKGGRVEKSKTPTKPHMYITHQPTTRPISETSQRSFGDGKVKAKTSVVNINSQNSKKERKKERKKERKKKRTSIIPGHTPSITLQSVEHAHCGLILYCNALRVMLSGVIAMERACLIVKWRHRIVRTSMLVVCFEEGVGWMALRVRGEIDVRDDYAWVGMRSMRGEMCNITLPCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.06
4 0.06
5 0.06
6 0.09
7 0.12
8 0.12
9 0.14
10 0.14
11 0.15
12 0.14
13 0.16
14 0.13
15 0.16
16 0.22
17 0.21
18 0.22
19 0.22
20 0.22
21 0.26
22 0.32
23 0.35
24 0.34
25 0.4
26 0.42
27 0.45
28 0.54
29 0.56
30 0.59
31 0.59
32 0.6
33 0.58
34 0.62
35 0.64
36 0.62
37 0.56
38 0.5
39 0.44
40 0.39
41 0.36
42 0.31
43 0.34
44 0.27
45 0.27
46 0.31
47 0.34
48 0.39
49 0.42
50 0.43
51 0.43
52 0.49
53 0.54
54 0.53
55 0.55
56 0.58
57 0.61
58 0.61
59 0.59
60 0.6
61 0.59
62 0.62
63 0.61
64 0.6
65 0.53
66 0.49
67 0.48
68 0.45
69 0.4
70 0.34
71 0.29
72 0.27
73 0.33
74 0.37
75 0.35
76 0.36
77 0.34
78 0.34
79 0.33
80 0.29
81 0.3
82 0.29
83 0.3
84 0.28
85 0.29
86 0.27
87 0.27
88 0.27
89 0.22
90 0.26
91 0.24
92 0.27
93 0.26
94 0.29
95 0.33
96 0.32
97 0.33
98 0.29
99 0.38
100 0.38
101 0.46
102 0.54
103 0.61
104 0.71
105 0.78
106 0.86
107 0.88
108 0.94
109 0.96
110 0.96
111 0.96
112 0.95
113 0.94
114 0.92
115 0.91
116 0.89
117 0.88
118 0.84
119 0.81
120 0.72
121 0.64
122 0.54
123 0.44
124 0.35
125 0.29
126 0.22
127 0.14
128 0.12
129 0.12
130 0.15
131 0.15
132 0.15
133 0.11
134 0.1
135 0.1
136 0.11
137 0.09
138 0.07
139 0.07
140 0.09
141 0.08
142 0.1
143 0.09
144 0.09
145 0.08
146 0.07
147 0.09
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.08
161 0.15
162 0.22
163 0.29
164 0.35
165 0.41
166 0.43
167 0.49
168 0.52
169 0.55
170 0.52
171 0.49
172 0.45
173 0.41
174 0.39
175 0.34
176 0.28
177 0.17
178 0.14
179 0.1
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.08
186 0.1
187 0.1
188 0.1
189 0.09
190 0.11
191 0.13
192 0.14
193 0.18
194 0.19
195 0.2
196 0.2
197 0.19
198 0.17
199 0.18
200 0.19
201 0.15
202 0.13
203 0.14
204 0.16
205 0.17
206 0.19
207 0.18
208 0.17
209 0.19
210 0.2
211 0.21
212 0.27