Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K6D5

Protein Details
Accession A0A5N6K6D5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-82QPQTSLPPKRKKKDVHPPHPPPPPNHBasic
NLS Segment(s)
PositionSequence
64-73PKRKKKDVHP
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQNAYAHRYLMRGKMGKAKVLIYGQLVRWVLFDCLYCITTFATLKPPLQHNHHPNLQPQTSLPPKRKKKDVHPPHPPPPPNHTHPQAPGPPNPPNPPLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.43
5 0.39
6 0.35
7 0.32
8 0.31
9 0.25
10 0.25
11 0.21
12 0.25
13 0.24
14 0.2
15 0.19
16 0.18
17 0.16
18 0.14
19 0.13
20 0.09
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.1
28 0.1
29 0.14
30 0.15
31 0.16
32 0.18
33 0.22
34 0.24
35 0.3
36 0.37
37 0.37
38 0.41
39 0.45
40 0.44
41 0.45
42 0.47
43 0.41
44 0.34
45 0.29
46 0.31
47 0.34
48 0.39
49 0.43
50 0.47
51 0.57
52 0.63
53 0.72
54 0.72
55 0.74
56 0.79
57 0.82
58 0.82
59 0.84
60 0.86
61 0.85
62 0.87
63 0.81
64 0.75
65 0.72
66 0.69
67 0.64
68 0.63
69 0.59
70 0.55
71 0.55
72 0.58
73 0.59
74 0.56
75 0.56
76 0.54
77 0.57
78 0.58
79 0.6
80 0.55