Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JU98

Protein Details
Accession A0A5N6JU98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-92YVNPTNMHAKRKKRGKGKRKTGCWYQRDRNARDHydrophilic
NLS Segment(s)
PositionSequence
68-79AKRKKRGKGKRK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MFALLLKVKVTASKRQPRHVNYYLKASLRLVLYIHENYLCWSYSFSQMIRSIHRCIFAHYVNPTNMHAKRKKRGKGKRKTGCWYQRDRNARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.7
4 0.7
5 0.76
6 0.75
7 0.73
8 0.66
9 0.68
10 0.63
11 0.55
12 0.5
13 0.41
14 0.36
15 0.27
16 0.25
17 0.17
18 0.13
19 0.16
20 0.15
21 0.15
22 0.12
23 0.11
24 0.11
25 0.13
26 0.12
27 0.08
28 0.09
29 0.1
30 0.13
31 0.14
32 0.13
33 0.15
34 0.18
35 0.19
36 0.22
37 0.24
38 0.24
39 0.24
40 0.28
41 0.25
42 0.25
43 0.28
44 0.25
45 0.26
46 0.25
47 0.28
48 0.25
49 0.27
50 0.25
51 0.28
52 0.31
53 0.36
54 0.41
55 0.46
56 0.55
57 0.63
58 0.7
59 0.74
60 0.81
61 0.83
62 0.87
63 0.89
64 0.9
65 0.9
66 0.89
67 0.9
68 0.89
69 0.87
70 0.86
71 0.85
72 0.84