Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JU35

Protein Details
Accession A0A5N6JU35    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-68PTSDQKWKDRGRRKTSGRRRRRKVGKEKEKEKKKDMEKEKBasic
NLS Segment(s)
PositionSequence
35-67WKDRGRRKTSGRRRRRKVGKEKEKEKKKDMEKE
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTFAPPFQSNQFAEVVTRKVVTGEAFPVPTSDQKWKDRGRRKTSGRRRRRKVGKEKEKEKKKDMEKEKDMEKDKDGEKTLIWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.17
4 0.17
5 0.14
6 0.14
7 0.15
8 0.13
9 0.12
10 0.13
11 0.13
12 0.13
13 0.13
14 0.13
15 0.13
16 0.14
17 0.16
18 0.21
19 0.25
20 0.28
21 0.36
22 0.43
23 0.51
24 0.59
25 0.67
26 0.68
27 0.72
28 0.77
29 0.8
30 0.84
31 0.85
32 0.87
33 0.87
34 0.87
35 0.88
36 0.9
37 0.89
38 0.9
39 0.9
40 0.9
41 0.9
42 0.92
43 0.92
44 0.92
45 0.89
46 0.84
47 0.82
48 0.8
49 0.8
50 0.8
51 0.8
52 0.76
53 0.75
54 0.74
55 0.74
56 0.7
57 0.64
58 0.56
59 0.52
60 0.48
61 0.49
62 0.46
63 0.39