Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K7W7

Protein Details
Accession A0A5N6K7W7   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-72DDPSVEKYSQKRRKQRFRGPWFDQQLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 23
Family & Domain DBs
Amino Acid Sequences MAEELSLPRLNRHNISSTSATPNLSRKRVRDTPPPDSSDPPIFSSDDDPSVEKYSQKRRKQRFRGPWFDQQLASDSAIEDEPLDRKVPIRNRRTFSKKVDSGVFMGSDGTDIDDAIMDNAKKAWPANNIVVPSPLKSRITLDIPKDIHAQRKIERCLENGEEYIDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.44
4 0.41
5 0.42
6 0.41
7 0.38
8 0.35
9 0.41
10 0.43
11 0.46
12 0.48
13 0.45
14 0.52
15 0.6
16 0.63
17 0.65
18 0.66
19 0.67
20 0.69
21 0.71
22 0.65
23 0.59
24 0.58
25 0.53
26 0.46
27 0.39
28 0.34
29 0.28
30 0.26
31 0.26
32 0.22
33 0.18
34 0.17
35 0.16
36 0.17
37 0.19
38 0.19
39 0.2
40 0.25
41 0.34
42 0.43
43 0.52
44 0.6
45 0.67
46 0.78
47 0.85
48 0.89
49 0.89
50 0.89
51 0.9
52 0.86
53 0.85
54 0.79
55 0.7
56 0.59
57 0.48
58 0.41
59 0.32
60 0.26
61 0.17
62 0.11
63 0.1
64 0.1
65 0.09
66 0.06
67 0.05
68 0.06
69 0.06
70 0.07
71 0.06
72 0.08
73 0.14
74 0.23
75 0.31
76 0.4
77 0.47
78 0.5
79 0.59
80 0.66
81 0.67
82 0.65
83 0.66
84 0.59
85 0.55
86 0.53
87 0.46
88 0.4
89 0.34
90 0.26
91 0.17
92 0.14
93 0.1
94 0.08
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.07
104 0.06
105 0.06
106 0.07
107 0.08
108 0.08
109 0.09
110 0.14
111 0.16
112 0.21
113 0.25
114 0.28
115 0.29
116 0.29
117 0.32
118 0.28
119 0.26
120 0.25
121 0.24
122 0.22
123 0.22
124 0.24
125 0.26
126 0.31
127 0.36
128 0.36
129 0.4
130 0.4
131 0.41
132 0.45
133 0.43
134 0.45
135 0.44
136 0.46
137 0.45
138 0.53
139 0.56
140 0.57
141 0.57
142 0.51
143 0.53
144 0.52
145 0.49
146 0.4
147 0.36