Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K602

Protein Details
Accession A0A5N6K602    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-37YWHLRTTWGKERKEKERKGKGKKRKGNFITFGSBasic
NLS Segment(s)
PositionSequence
14-30KERKEKERKGKGKKRKG
Subcellular Location(s) nucl 15, plas 5, mito 3.5, cyto_mito 2.5, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSTYWHLRTTWGKERKEKERKGKGKKRKGNFITFGSREEKEGILNTSIHSIHPSSSSPSTTTNNNNNNNNNNIIIIIIIIIINQNHIYLFFLFLFPFSFGISPLEPLWSTFNTLAFCSLLTHNSLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.74
3 0.76
4 0.79
5 0.81
6 0.82
7 0.84
8 0.88
9 0.9
10 0.92
11 0.92
12 0.93
13 0.92
14 0.9
15 0.9
16 0.88
17 0.86
18 0.81
19 0.76
20 0.73
21 0.65
22 0.59
23 0.52
24 0.45
25 0.36
26 0.32
27 0.26
28 0.18
29 0.18
30 0.17
31 0.14
32 0.14
33 0.12
34 0.13
35 0.13
36 0.12
37 0.12
38 0.11
39 0.1
40 0.11
41 0.11
42 0.12
43 0.14
44 0.14
45 0.14
46 0.17
47 0.18
48 0.2
49 0.25
50 0.29
51 0.36
52 0.4
53 0.44
54 0.44
55 0.45
56 0.44
57 0.4
58 0.32
59 0.24
60 0.19
61 0.14
62 0.1
63 0.07
64 0.05
65 0.04
66 0.03
67 0.03
68 0.04
69 0.03
70 0.04
71 0.05
72 0.05
73 0.04
74 0.05
75 0.07
76 0.06
77 0.08
78 0.08
79 0.09
80 0.08
81 0.09
82 0.1
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.11
89 0.11
90 0.12
91 0.11
92 0.13
93 0.13
94 0.14
95 0.17
96 0.15
97 0.18
98 0.17
99 0.2
100 0.19
101 0.19
102 0.2
103 0.16
104 0.16
105 0.15
106 0.15
107 0.14
108 0.16