Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JZY6

Protein Details
Accession A0A5N6JZY6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GLHLRVRHDTRTRTRRHRHDKLIQGDGBasic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7.5, nucl 6, cyto_pero 4.5
Family & Domain DBs
Amino Acid Sequences MSKDDGSFYGLHLRVRHDTRTRTRRHRHDKLIQGDGIQLTRGNFWLGTLANGGGDSGLYLRLVGMGRMEIPAFMLLAHAIRYGRAALKDACRTITTGQPGFPWMVYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.44
4 0.42
5 0.5
6 0.57
7 0.65
8 0.71
9 0.74
10 0.81
11 0.84
12 0.88
13 0.89
14 0.88
15 0.88
16 0.87
17 0.83
18 0.78
19 0.68
20 0.57
21 0.49
22 0.4
23 0.3
24 0.21
25 0.15
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.07
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.12
72 0.15
73 0.18
74 0.25
75 0.3
76 0.3
77 0.31
78 0.29
79 0.31
80 0.3
81 0.33
82 0.33
83 0.3
84 0.29
85 0.28
86 0.29
87 0.28