Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K1Q6

Protein Details
Accession A0A5N6K1Q6    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-69WRWIWRWSWRWRWRWRWGWRMKMDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7.5, nucl 5, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences MFEHIPAQQLIRPRRFWLWEAGAVGWGKRDLEEGRGGRRRIIWSWRWIWRWSWRWRWRWRWGWRMKMDDKRKGCIFFRWQEKVSFRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.46
4 0.46
5 0.42
6 0.39
7 0.38
8 0.34
9 0.31
10 0.27
11 0.25
12 0.18
13 0.14
14 0.11
15 0.09
16 0.12
17 0.1
18 0.12
19 0.19
20 0.2
21 0.27
22 0.33
23 0.33
24 0.32
25 0.34
26 0.34
27 0.31
28 0.36
29 0.32
30 0.32
31 0.37
32 0.42
33 0.42
34 0.4
35 0.41
36 0.43
37 0.48
38 0.5
39 0.56
40 0.58
41 0.65
42 0.74
43 0.79
44 0.8
45 0.81
46 0.82
47 0.82
48 0.82
49 0.83
50 0.8
51 0.8
52 0.79
53 0.79
54 0.79
55 0.78
56 0.73
57 0.7
58 0.68
59 0.65
60 0.59
61 0.57
62 0.56
63 0.55
64 0.61
65 0.61
66 0.58
67 0.61