Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KI70

Protein Details
Accession A0A5N6KI70   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-75ALLCIIKGKRNRNNKKLKFFNQPTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, cyto_nucl 11, golg 2, mito 5, nucl 12
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGRDGSEEDEDSSEDKKEEGISKTSKVEFVLCFVLFCFVLFCFVLFCFALLCIIKGKRNRNNKKLKFFNQPTSTLLDQFFQIFSLMVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.11
5 0.13
6 0.18
7 0.19
8 0.24
9 0.25
10 0.28
11 0.32
12 0.31
13 0.29
14 0.25
15 0.25
16 0.19
17 0.19
18 0.19
19 0.16
20 0.15
21 0.13
22 0.14
23 0.11
24 0.1
25 0.08
26 0.05
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.07
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.09
41 0.11
42 0.16
43 0.22
44 0.32
45 0.39
46 0.5
47 0.6
48 0.67
49 0.77
50 0.82
51 0.86
52 0.87
53 0.85
54 0.86
55 0.83
56 0.83
57 0.76
58 0.7
59 0.61
60 0.57
61 0.51
62 0.43
63 0.36
64 0.27
65 0.22
66 0.2
67 0.19
68 0.13
69 0.12