Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JUV0

Protein Details
Accession A0A5N6JUV0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
178-202AGKLLRRWVREKQDLKRRRLWKVIVHydrophilic
NLS Segment(s)
PositionSequence
193-195KRR
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR025714  Methyltranfer_dom  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13847  Methyltransf_31  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MTSKEPTYSLGYSPAVVDRHSLRRASTCCSYFLPHLNPTSCILDLGCGPGSITTDVALLISRGSIIGLDAGPTVVDIANAKAKELGLSNCSFQVGDVMKLPFDDETFDVVYTHQLLIHLPDPVAAIKEMKRVCKVGGFVACRESDMDDAVFYPSTHSLKRSVQIMEAMIREKGSEPQAGKLLRRWVREKQDLKRRRLWKVIVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.18
4 0.21
5 0.21
6 0.28
7 0.32
8 0.32
9 0.3
10 0.37
11 0.39
12 0.42
13 0.44
14 0.38
15 0.38
16 0.39
17 0.4
18 0.36
19 0.4
20 0.38
21 0.35
22 0.39
23 0.37
24 0.36
25 0.36
26 0.36
27 0.29
28 0.24
29 0.2
30 0.16
31 0.14
32 0.15
33 0.12
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.1
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.11
71 0.12
72 0.12
73 0.11
74 0.12
75 0.13
76 0.12
77 0.12
78 0.11
79 0.09
80 0.12
81 0.1
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.07
89 0.07
90 0.07
91 0.06
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.08
99 0.08
100 0.06
101 0.06
102 0.06
103 0.08
104 0.09
105 0.09
106 0.07
107 0.08
108 0.08
109 0.08
110 0.09
111 0.07
112 0.08
113 0.09
114 0.15
115 0.17
116 0.19
117 0.22
118 0.22
119 0.23
120 0.24
121 0.24
122 0.23
123 0.27
124 0.27
125 0.25
126 0.27
127 0.26
128 0.23
129 0.23
130 0.19
131 0.13
132 0.12
133 0.11
134 0.08
135 0.09
136 0.1
137 0.09
138 0.08
139 0.09
140 0.12
141 0.14
142 0.15
143 0.16
144 0.19
145 0.23
146 0.26
147 0.28
148 0.26
149 0.26
150 0.27
151 0.27
152 0.25
153 0.24
154 0.22
155 0.18
156 0.17
157 0.16
158 0.15
159 0.17
160 0.17
161 0.21
162 0.21
163 0.24
164 0.31
165 0.33
166 0.34
167 0.35
168 0.42
169 0.43
170 0.48
171 0.51
172 0.54
173 0.61
174 0.7
175 0.73
176 0.74
177 0.79
178 0.81
179 0.83
180 0.83
181 0.82
182 0.8
183 0.81