Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KAX2

Protein Details
Accession A0A5N6KAX2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-69ISTAKAPHKLRPPKICNPQSIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MSGPPYPGSHQVISSASCRKQGIVNTSHCKLVFQCSYSQPLSIYPILISTAKAPHKLRPPKICNPQSIFPVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.27
5 0.27
6 0.26
7 0.28
8 0.31
9 0.33
10 0.33
11 0.39
12 0.41
13 0.42
14 0.43
15 0.39
16 0.35
17 0.29
18 0.29
19 0.23
20 0.19
21 0.21
22 0.2
23 0.24
24 0.24
25 0.24
26 0.17
27 0.16
28 0.18
29 0.15
30 0.14
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.09
37 0.15
38 0.17
39 0.23
40 0.25
41 0.3
42 0.41
43 0.5
44 0.58
45 0.62
46 0.68
47 0.72
48 0.82
49 0.82
50 0.8
51 0.77
52 0.73