Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JTT6

Protein Details
Accession A0A5N6JTT6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-126NEIGIPMPKKPRGKKRRVATGDENGDESATPSLSPKKRKTKPYIPTLRSGHydrophilic
NLS Segment(s)
PositionSequence
84-93PKKPRGKKRR
Subcellular Location(s) nucl 17, cyto 5, pero 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027421  DNA_pol_lamdba_lyase_dom_sf  
IPR042530  EME1/EME2_C  
IPR006166  ERCC4_domain  
IPR033309  Mus81  
IPR011335  Restrct_endonuc-II-like  
IPR036388  WH-like_DNA-bd_sf  
IPR047417  WH_MUS81  
IPR047416  XPF_nuclease_Mus81  
Gene Ontology GO:0048476  C:Holliday junction resolvase complex  
GO:0005634  C:nucleus  
GO:0008821  F:crossover junction DNA endonuclease activity  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006308  P:DNA catabolic process  
GO:0000727  P:double-strand break repair via break-induced replication  
GO:0051321  P:meiotic cell cycle  
Pfam View protein in Pfam  
PF02732  ERCC4  
CDD cd21036  WH_MUS81  
cd20074  XPF_nuclease_Mus81  
Amino Acid Sequences MAPSNECGNPLLLKWLEEWVVEAQERGYRSLPALKKARDSIKGCPQRFDHPSEAISLNGIGEGLVKRLTDSLEKYCNEIGIPMPKKPRGKKRRVATGDENGDESATPSLSPKKRKTKPYIPTLRSGAYAILLALSTQPRNSRIGITQEEIITLAEPHCDSPFTQTRPSEYYTAWNSMKTLINKDFVYTKKNPATRYYLTDEGWDLADTMKASGDPTLGRAQNFEPAPPGPSSNAGTGMRVVNEDINHDSELEEIQPVSLSQSHTNPNIPDIPDGDSMSIPTFQPIVLRPGTFTVELILDNREVASKKDRDGISNQLTDMGVPHSVRALPLGDFLWVARVREDKVKWTGLGKSNLIVLDYIMERKRLDDLIGSIKDGRYEEQKFRLKRSGITNVKYLIENKRVDAAIMERWSDGITTSIAKMKVQDGIYVKQTQDLGESLRYIKRMTTLLQAQYESKPLYVIPTQVLTVKNHSPLMAHLRQTHPEKEHNIEFDAFAALSNKSQNLTLKDIFLKMLMRTKGISALKAIEIQKRWPTPVAFLEAYERLSKRTTHDDDNQDNDDSRAVPKPKGKGVAVILDPEELLAKRKRALVSNELGALVGNGKVQGALSAKLAEVWGGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.21
4 0.2
5 0.22
6 0.17
7 0.2
8 0.19
9 0.18
10 0.16
11 0.19
12 0.2
13 0.21
14 0.2
15 0.17
16 0.2
17 0.29
18 0.32
19 0.38
20 0.46
21 0.47
22 0.52
23 0.59
24 0.64
25 0.64
26 0.63
27 0.63
28 0.65
29 0.72
30 0.66
31 0.65
32 0.61
33 0.61
34 0.62
35 0.61
36 0.55
37 0.48
38 0.47
39 0.45
40 0.43
41 0.33
42 0.29
43 0.22
44 0.16
45 0.12
46 0.11
47 0.06
48 0.08
49 0.08
50 0.09
51 0.1
52 0.1
53 0.1
54 0.12
55 0.14
56 0.17
57 0.21
58 0.26
59 0.32
60 0.33
61 0.36
62 0.35
63 0.34
64 0.29
65 0.26
66 0.23
67 0.26
68 0.28
69 0.31
70 0.37
71 0.44
72 0.53
73 0.62
74 0.69
75 0.7
76 0.78
77 0.82
78 0.84
79 0.89
80 0.86
81 0.85
82 0.83
83 0.81
84 0.77
85 0.68
86 0.59
87 0.48
88 0.41
89 0.32
90 0.25
91 0.16
92 0.09
93 0.08
94 0.1
95 0.19
96 0.26
97 0.35
98 0.44
99 0.54
100 0.62
101 0.73
102 0.81
103 0.82
104 0.84
105 0.86
106 0.88
107 0.8
108 0.79
109 0.72
110 0.64
111 0.54
112 0.45
113 0.35
114 0.24
115 0.2
116 0.13
117 0.09
118 0.07
119 0.06
120 0.08
121 0.1
122 0.1
123 0.12
124 0.15
125 0.17
126 0.2
127 0.21
128 0.22
129 0.23
130 0.29
131 0.3
132 0.3
133 0.3
134 0.27
135 0.26
136 0.23
137 0.19
138 0.13
139 0.1
140 0.09
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.1
147 0.17
148 0.24
149 0.26
150 0.32
151 0.32
152 0.36
153 0.39
154 0.41
155 0.36
156 0.29
157 0.32
158 0.29
159 0.35
160 0.31
161 0.28
162 0.26
163 0.27
164 0.31
165 0.27
166 0.3
167 0.27
168 0.3
169 0.29
170 0.3
171 0.32
172 0.29
173 0.34
174 0.31
175 0.36
176 0.39
177 0.43
178 0.44
179 0.44
180 0.5
181 0.45
182 0.48
183 0.45
184 0.41
185 0.38
186 0.37
187 0.32
188 0.25
189 0.23
190 0.17
191 0.11
192 0.08
193 0.09
194 0.08
195 0.07
196 0.06
197 0.06
198 0.06
199 0.06
200 0.07
201 0.06
202 0.09
203 0.14
204 0.16
205 0.16
206 0.17
207 0.18
208 0.23
209 0.23
210 0.2
211 0.17
212 0.16
213 0.18
214 0.17
215 0.17
216 0.12
217 0.15
218 0.16
219 0.14
220 0.18
221 0.16
222 0.16
223 0.16
224 0.16
225 0.14
226 0.12
227 0.12
228 0.1
229 0.1
230 0.11
231 0.11
232 0.12
233 0.12
234 0.12
235 0.11
236 0.1
237 0.1
238 0.08
239 0.07
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.07
246 0.09
247 0.1
248 0.13
249 0.16
250 0.18
251 0.2
252 0.19
253 0.19
254 0.21
255 0.2
256 0.17
257 0.16
258 0.18
259 0.16
260 0.17
261 0.15
262 0.12
263 0.12
264 0.12
265 0.11
266 0.08
267 0.07
268 0.07
269 0.06
270 0.07
271 0.08
272 0.11
273 0.11
274 0.11
275 0.11
276 0.13
277 0.14
278 0.13
279 0.12
280 0.09
281 0.08
282 0.09
283 0.09
284 0.08
285 0.07
286 0.06
287 0.06
288 0.07
289 0.07
290 0.09
291 0.15
292 0.15
293 0.17
294 0.23
295 0.24
296 0.24
297 0.27
298 0.32
299 0.3
300 0.29
301 0.28
302 0.23
303 0.22
304 0.2
305 0.17
306 0.11
307 0.08
308 0.07
309 0.07
310 0.07
311 0.07
312 0.07
313 0.07
314 0.07
315 0.06
316 0.07
317 0.07
318 0.07
319 0.07
320 0.07
321 0.1
322 0.1
323 0.1
324 0.1
325 0.12
326 0.13
327 0.19
328 0.2
329 0.2
330 0.23
331 0.25
332 0.24
333 0.25
334 0.29
335 0.29
336 0.32
337 0.28
338 0.24
339 0.24
340 0.24
341 0.22
342 0.16
343 0.1
344 0.08
345 0.08
346 0.11
347 0.1
348 0.11
349 0.11
350 0.11
351 0.13
352 0.12
353 0.13
354 0.1
355 0.12
356 0.18
357 0.18
358 0.18
359 0.17
360 0.17
361 0.18
362 0.17
363 0.16
364 0.16
365 0.2
366 0.23
367 0.31
368 0.39
369 0.4
370 0.44
371 0.5
372 0.45
373 0.46
374 0.49
375 0.51
376 0.5
377 0.51
378 0.49
379 0.43
380 0.43
381 0.39
382 0.36
383 0.31
384 0.32
385 0.3
386 0.27
387 0.29
388 0.28
389 0.26
390 0.24
391 0.2
392 0.17
393 0.17
394 0.17
395 0.14
396 0.14
397 0.14
398 0.13
399 0.11
400 0.07
401 0.07
402 0.07
403 0.08
404 0.12
405 0.12
406 0.13
407 0.14
408 0.14
409 0.18
410 0.18
411 0.21
412 0.21
413 0.23
414 0.27
415 0.28
416 0.27
417 0.24
418 0.24
419 0.2
420 0.18
421 0.16
422 0.14
423 0.13
424 0.14
425 0.14
426 0.16
427 0.17
428 0.16
429 0.15
430 0.16
431 0.17
432 0.18
433 0.22
434 0.26
435 0.29
436 0.3
437 0.31
438 0.3
439 0.3
440 0.31
441 0.25
442 0.19
443 0.16
444 0.14
445 0.16
446 0.16
447 0.16
448 0.14
449 0.14
450 0.15
451 0.18
452 0.21
453 0.19
454 0.22
455 0.24
456 0.25
457 0.25
458 0.24
459 0.21
460 0.23
461 0.29
462 0.29
463 0.3
464 0.32
465 0.34
466 0.41
467 0.45
468 0.48
469 0.43
470 0.45
471 0.46
472 0.47
473 0.48
474 0.44
475 0.42
476 0.36
477 0.32
478 0.26
479 0.22
480 0.16
481 0.12
482 0.12
483 0.09
484 0.1
485 0.12
486 0.12
487 0.12
488 0.14
489 0.19
490 0.21
491 0.27
492 0.27
493 0.29
494 0.3
495 0.31
496 0.28
497 0.25
498 0.23
499 0.19
500 0.26
501 0.23
502 0.23
503 0.23
504 0.23
505 0.3
506 0.29
507 0.27
508 0.22
509 0.23
510 0.23
511 0.28
512 0.31
513 0.29
514 0.3
515 0.34
516 0.41
517 0.41
518 0.43
519 0.42
520 0.4
521 0.38
522 0.4
523 0.41
524 0.33
525 0.31
526 0.33
527 0.29
528 0.3
529 0.3
530 0.27
531 0.22
532 0.24
533 0.26
534 0.26
535 0.35
536 0.38
537 0.4
538 0.49
539 0.56
540 0.6
541 0.64
542 0.62
543 0.54
544 0.49
545 0.42
546 0.34
547 0.26
548 0.23
549 0.25
550 0.26
551 0.3
552 0.35
553 0.41
554 0.47
555 0.52
556 0.5
557 0.49
558 0.5
559 0.51
560 0.46
561 0.42
562 0.36
563 0.29
564 0.28
565 0.21
566 0.2
567 0.13
568 0.17
569 0.2
570 0.22
571 0.25
572 0.31
573 0.35
574 0.4
575 0.47
576 0.5
577 0.5
578 0.51
579 0.49
580 0.43
581 0.39
582 0.31
583 0.25
584 0.17
585 0.12
586 0.09
587 0.07
588 0.07
589 0.08
590 0.08
591 0.11
592 0.12
593 0.13
594 0.14
595 0.15
596 0.15
597 0.15
598 0.15
599 0.12