Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SU57

Protein Details
Accession Q8SU57    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
53-74YALYKLRKYKKALRVLRRMDTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, cyto 3, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:1990904  C:ribonucleoprotein complex  
KEGG ecu:ECU11_0680  -  
Pfam View protein in Pfam  
PF17004  SRP_TPR_like  
Amino Acid Sequences MNLRDLVKNGRHEEISRLEHPELGQFRAVAYINMGRFSEALKYAAKNSFERAYALYKLRKYKKALRVLRRMDTEGSRVLASQCLYYLGYYNTAYKMLAEVKRDDDVVVNLQAMKSLAILADSNQYVFGNRFQIRKRDQLAEFEDLTKCQLKDPEGRIDFIFNLSFESLFDEEMFVSFLSSQLERPEMKGTILEEQLKNIKGEAVAMDLLLRNQRETVEFNNGAIERLSNPLHFQQNFSGADGGAVRGNICLWIEKVYSSNFSIKAQEIPLLSPKMVLLRILTLCKNGALPSRKLMSRVRTWPESSIKACLSVFDPEIHLDKELYVRMSQTIMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.42
4 0.44
5 0.4
6 0.39
7 0.38
8 0.4
9 0.34
10 0.3
11 0.29
12 0.23
13 0.22
14 0.24
15 0.24
16 0.16
17 0.17
18 0.19
19 0.18
20 0.2
21 0.2
22 0.17
23 0.17
24 0.18
25 0.19
26 0.15
27 0.16
28 0.18
29 0.19
30 0.23
31 0.29
32 0.31
33 0.29
34 0.32
35 0.33
36 0.31
37 0.31
38 0.29
39 0.27
40 0.29
41 0.34
42 0.36
43 0.39
44 0.48
45 0.54
46 0.59
47 0.62
48 0.68
49 0.71
50 0.75
51 0.79
52 0.79
53 0.82
54 0.82
55 0.81
56 0.75
57 0.69
58 0.62
59 0.55
60 0.48
61 0.39
62 0.33
63 0.26
64 0.22
65 0.2
66 0.18
67 0.16
68 0.13
69 0.11
70 0.11
71 0.11
72 0.11
73 0.12
74 0.1
75 0.12
76 0.12
77 0.14
78 0.13
79 0.13
80 0.13
81 0.11
82 0.13
83 0.17
84 0.19
85 0.2
86 0.21
87 0.23
88 0.24
89 0.24
90 0.22
91 0.17
92 0.15
93 0.15
94 0.14
95 0.12
96 0.11
97 0.11
98 0.11
99 0.1
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.1
114 0.11
115 0.15
116 0.17
117 0.22
118 0.24
119 0.33
120 0.36
121 0.42
122 0.44
123 0.44
124 0.43
125 0.45
126 0.46
127 0.41
128 0.38
129 0.33
130 0.29
131 0.22
132 0.23
133 0.2
134 0.16
135 0.14
136 0.15
137 0.16
138 0.23
139 0.27
140 0.34
141 0.32
142 0.33
143 0.31
144 0.3
145 0.27
146 0.21
147 0.18
148 0.09
149 0.09
150 0.08
151 0.07
152 0.06
153 0.08
154 0.07
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.07
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.06
168 0.07
169 0.1
170 0.1
171 0.11
172 0.13
173 0.13
174 0.13
175 0.13
176 0.13
177 0.14
178 0.16
179 0.19
180 0.16
181 0.17
182 0.21
183 0.21
184 0.2
185 0.16
186 0.15
187 0.11
188 0.11
189 0.1
190 0.08
191 0.07
192 0.06
193 0.07
194 0.06
195 0.07
196 0.09
197 0.09
198 0.08
199 0.09
200 0.1
201 0.11
202 0.14
203 0.16
204 0.21
205 0.21
206 0.21
207 0.24
208 0.23
209 0.22
210 0.19
211 0.17
212 0.1
213 0.13
214 0.14
215 0.11
216 0.13
217 0.17
218 0.24
219 0.24
220 0.25
221 0.24
222 0.29
223 0.29
224 0.28
225 0.24
226 0.17
227 0.17
228 0.15
229 0.14
230 0.09
231 0.08
232 0.07
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.1
240 0.1
241 0.11
242 0.13
243 0.14
244 0.16
245 0.18
246 0.21
247 0.2
248 0.21
249 0.23
250 0.22
251 0.23
252 0.21
253 0.22
254 0.19
255 0.19
256 0.24
257 0.23
258 0.22
259 0.19
260 0.19
261 0.19
262 0.18
263 0.17
264 0.12
265 0.15
266 0.18
267 0.21
268 0.22
269 0.21
270 0.21
271 0.21
272 0.21
273 0.19
274 0.25
275 0.27
276 0.28
277 0.33
278 0.38
279 0.38
280 0.42
281 0.46
282 0.46
283 0.49
284 0.55
285 0.57
286 0.57
287 0.58
288 0.61
289 0.61
290 0.6
291 0.53
292 0.5
293 0.44
294 0.41
295 0.38
296 0.32
297 0.28
298 0.25
299 0.24
300 0.2
301 0.21
302 0.2
303 0.24
304 0.23
305 0.22
306 0.18
307 0.18
308 0.2
309 0.21
310 0.21
311 0.19
312 0.19
313 0.19