Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KDR3

Protein Details
Accession A0A5N6KDR3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-83ANFSSEAKPRERKRNRNRNRRRIPLPNLCSTTHydrophilic
NLS Segment(s)
PositionSequence
59-73KPRERKRNRNRNRRR
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MFGYLMLGHYDSAFANYLTHLTHHPHLPFPKEKQSHKKSWYLYQSMQASPPANFSSEAKPRERKRNRNRNRRRIPLPNLCSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.09
6 0.1
7 0.11
8 0.14
9 0.16
10 0.2
11 0.21
12 0.26
13 0.29
14 0.34
15 0.38
16 0.38
17 0.46
18 0.48
19 0.54
20 0.6
21 0.64
22 0.67
23 0.66
24 0.68
25 0.61
26 0.62
27 0.61
28 0.55
29 0.48
30 0.45
31 0.43
32 0.37
33 0.35
34 0.3
35 0.24
36 0.2
37 0.21
38 0.15
39 0.14
40 0.14
41 0.15
42 0.2
43 0.26
44 0.29
45 0.33
46 0.42
47 0.48
48 0.59
49 0.67
50 0.71
51 0.76
52 0.83
53 0.88
54 0.91
55 0.95
56 0.95
57 0.95
58 0.94
59 0.93
60 0.92
61 0.91
62 0.91
63 0.86