Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KJ66

Protein Details
Accession A0A5N6KJ66    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-85SFHPTKCKSHPSDPKRKSEKTPVNLCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6.5, cyto_mito 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSRVTTLSQEKPTICSPLNPTCFCLISFPRLNCVIVSSCIHPSTSSYDNPSLPMNFLHSFHPTKCKSHPSDPKRKSEKTPVNLCSHFVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.33
4 0.38
5 0.44
6 0.41
7 0.41
8 0.38
9 0.38
10 0.34
11 0.33
12 0.25
13 0.26
14 0.3
15 0.28
16 0.29
17 0.3
18 0.3
19 0.25
20 0.25
21 0.19
22 0.16
23 0.17
24 0.15
25 0.15
26 0.15
27 0.15
28 0.13
29 0.13
30 0.15
31 0.16
32 0.16
33 0.17
34 0.19
35 0.19
36 0.2
37 0.2
38 0.16
39 0.14
40 0.14
41 0.15
42 0.14
43 0.15
44 0.16
45 0.19
46 0.21
47 0.22
48 0.31
49 0.29
50 0.32
51 0.36
52 0.43
53 0.46
54 0.54
55 0.63
56 0.65
57 0.74
58 0.77
59 0.82
60 0.82
61 0.81
62 0.79
63 0.79
64 0.79
65 0.77
66 0.8
67 0.76
68 0.75
69 0.71