Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6JYW0

Protein Details
Accession A0A5N6JYW0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-75EEGEREKREKRAKRENKENKENKENKEBasic
NLS Segment(s)
PositionSequence
53-93REKREKRAKRENKENKENKENKENKENKENKENKENKDNKK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MQVNVTDDTVQDRLTQKQGRTTGRKMGILRLETWSVLKRRSVNENEEEEEGEREKREKRAKRENKENKENKENKENKENKENKENKENKDNKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.32
4 0.39
5 0.46
6 0.51
7 0.56
8 0.56
9 0.57
10 0.55
11 0.59
12 0.52
13 0.51
14 0.48
15 0.42
16 0.39
17 0.33
18 0.3
19 0.25
20 0.25
21 0.24
22 0.2
23 0.2
24 0.22
25 0.23
26 0.25
27 0.32
28 0.35
29 0.35
30 0.38
31 0.39
32 0.37
33 0.34
34 0.32
35 0.25
36 0.21
37 0.17
38 0.13
39 0.1
40 0.11
41 0.14
42 0.22
43 0.31
44 0.38
45 0.46
46 0.57
47 0.67
48 0.75
49 0.83
50 0.86
51 0.87
52 0.9
53 0.89
54 0.86
55 0.86
56 0.84
57 0.78
58 0.78
59 0.75
60 0.7
61 0.73
62 0.72
63 0.67
64 0.71
65 0.72
66 0.67
67 0.71
68 0.72
69 0.67
70 0.71
71 0.73
72 0.69
73 0.73
74 0.76