Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K0C9

Protein Details
Accession A0A5N6K0C9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-92GVSKRSVTKKRKFTSGKKAEVPRKRMLHydrophilic
NLS Segment(s)
PositionSequence
66-97GVSKRSVTKKRKFTSGKKAEVPRKRMLREKGA
Subcellular Location(s) cyto_nucl 11, mito 6, nucl 18.5
Family & Domain DBs
Amino Acid Sequences METWSTRARQRASKKLDSPGDPFGNNYIAAKGVEFEDSIIDRSGGEYGKDGKEEKLKEKGEEEGVGVSKRSVTKKRKFTSGKKAEVPRKRMLREKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.74
4 0.69
5 0.64
6 0.61
7 0.56
8 0.46
9 0.42
10 0.35
11 0.29
12 0.25
13 0.21
14 0.14
15 0.11
16 0.11
17 0.1
18 0.08
19 0.07
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.07
34 0.09
35 0.1
36 0.11
37 0.12
38 0.12
39 0.18
40 0.2
41 0.23
42 0.29
43 0.3
44 0.31
45 0.31
46 0.32
47 0.28
48 0.26
49 0.22
50 0.16
51 0.16
52 0.15
53 0.14
54 0.11
55 0.12
56 0.15
57 0.21
58 0.29
59 0.38
60 0.47
61 0.58
62 0.62
63 0.7
64 0.76
65 0.79
66 0.81
67 0.81
68 0.8
69 0.78
70 0.83
71 0.83
72 0.83
73 0.8
74 0.78
75 0.78
76 0.76
77 0.77