Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JV36

Protein Details
Accession A0A5N6JV36   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-61ISYGNDGQRKKKKREKMRYKCRESRRRLMAYSHydrophilic
NLS Segment(s)
PositionSequence
38-54RKKKKREKMRYKCRESR
Subcellular Location(s) E.R. 3, cyto 4.5, cyto_nucl 4.5, mito 5, nucl 3.5, plas 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKGVGGIKEEMTIILIFAISFFFFLLLYISYGNDGQRKKKKREKMRYKCRESRRRLMAYSVCSIRMKMESISYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.07
20 0.08
21 0.12
22 0.14
23 0.22
24 0.3
25 0.38
26 0.47
27 0.55
28 0.64
29 0.71
30 0.8
31 0.84
32 0.86
33 0.9
34 0.92
35 0.93
36 0.92
37 0.92
38 0.91
39 0.88
40 0.87
41 0.85
42 0.8
43 0.72
44 0.71
45 0.65
46 0.59
47 0.57
48 0.49
49 0.43
50 0.37
51 0.36
52 0.3
53 0.27
54 0.25
55 0.2