Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8STD9

Protein Details
Accession Q8STD9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-39ASGTRKDKKKWGDGRKKEEVRRABasic
NLS Segment(s)
PositionSequence
8-37SKEKKALKAASGTRKDKKKWGDGRKKEEVR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ecu:ECU08_1040  -  
ecu:ECU08_1070  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKKIQESKEKKALKAASGTRKDKKKWGDGRKKEEVRRAVTVSEELLAKVRKDVGRASVVTRYMIGSRYNLNLGVAENVLRHLSNEGVVQQVLGNRRMTIYAGCRAQEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.56
4 0.56
5 0.6
6 0.66
7 0.66
8 0.7
9 0.7
10 0.7
11 0.69
12 0.69
13 0.7
14 0.74
15 0.77
16 0.79
17 0.84
18 0.86
19 0.87
20 0.82
21 0.8
22 0.75
23 0.69
24 0.63
25 0.56
26 0.46
27 0.39
28 0.33
29 0.25
30 0.19
31 0.14
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.14
38 0.13
39 0.15
40 0.16
41 0.16
42 0.18
43 0.18
44 0.2
45 0.19
46 0.19
47 0.17
48 0.17
49 0.14
50 0.12
51 0.13
52 0.12
53 0.1
54 0.12
55 0.13
56 0.13
57 0.13
58 0.12
59 0.11
60 0.1
61 0.1
62 0.09
63 0.08
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.13
79 0.15
80 0.18
81 0.18
82 0.17
83 0.18
84 0.19
85 0.19
86 0.2
87 0.22
88 0.26
89 0.28