Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KDY4

Protein Details
Accession A0A5N6KDY4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
151-173TDQGTKPVARKRRKPWENDVDEEHydrophilic
NLS Segment(s)
PositionSequence
161-163KRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MVDLNSEQSENSNINIYKDLESYPWSTDNEFQGGLSAILGNASSPDQIRELTLRAQCFYLSRKKNVVIDFDGYKAYLTTQSSDPSMTTALPLNNTPSSNAPLHHENDLPPASTTTDQTTALYPPSFAEIVAMIQAGTPIPGIRDIPDTVLTDQGTKPVARKRRKPWENDVDEETIQGGGTFGDHRDIIIQQEYPTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.25
4 0.23
5 0.24
6 0.24
7 0.19
8 0.21
9 0.21
10 0.21
11 0.22
12 0.22
13 0.22
14 0.25
15 0.26
16 0.25
17 0.23
18 0.2
19 0.18
20 0.17
21 0.15
22 0.11
23 0.08
24 0.06
25 0.06
26 0.06
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.08
33 0.09
34 0.09
35 0.11
36 0.11
37 0.13
38 0.18
39 0.21
40 0.21
41 0.21
42 0.21
43 0.2
44 0.21
45 0.24
46 0.28
47 0.3
48 0.33
49 0.36
50 0.39
51 0.44
52 0.44
53 0.44
54 0.37
55 0.35
56 0.32
57 0.28
58 0.25
59 0.2
60 0.17
61 0.12
62 0.1
63 0.1
64 0.09
65 0.11
66 0.12
67 0.13
68 0.13
69 0.13
70 0.13
71 0.11
72 0.11
73 0.08
74 0.08
75 0.09
76 0.09
77 0.09
78 0.1
79 0.12
80 0.12
81 0.13
82 0.13
83 0.12
84 0.15
85 0.15
86 0.15
87 0.15
88 0.17
89 0.19
90 0.19
91 0.19
92 0.16
93 0.19
94 0.19
95 0.16
96 0.14
97 0.13
98 0.13
99 0.13
100 0.13
101 0.12
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.13
108 0.12
109 0.1
110 0.09
111 0.11
112 0.1
113 0.09
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.06
129 0.07
130 0.1
131 0.11
132 0.12
133 0.15
134 0.16
135 0.16
136 0.19
137 0.18
138 0.17
139 0.16
140 0.17
141 0.17
142 0.15
143 0.2
144 0.25
145 0.35
146 0.42
147 0.52
148 0.61
149 0.7
150 0.78
151 0.81
152 0.84
153 0.85
154 0.82
155 0.77
156 0.71
157 0.64
158 0.56
159 0.48
160 0.37
161 0.26
162 0.19
163 0.14
164 0.09
165 0.05
166 0.06
167 0.07
168 0.07
169 0.09
170 0.09
171 0.1
172 0.12
173 0.13
174 0.15
175 0.17
176 0.18
177 0.16