Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KJ60

Protein Details
Accession A0A5N6KJ60   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-71RTTANKLKKKENRVYCRGRSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 25
Family & Domain DBs
Amino Acid Sequences MQPRRLQDEPFFSSDKRPREESAEERCRHEMSARDYQVKNPFDTPKSNENQRTTANKLKKKENRVYCRGRSGYKLSCAVARIVPCARDRRCHIESC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.46
4 0.45
5 0.43
6 0.47
7 0.53
8 0.51
9 0.55
10 0.58
11 0.55
12 0.55
13 0.55
14 0.49
15 0.43
16 0.39
17 0.34
18 0.31
19 0.39
20 0.38
21 0.41
22 0.41
23 0.45
24 0.5
25 0.45
26 0.4
27 0.34
28 0.35
29 0.32
30 0.35
31 0.35
32 0.33
33 0.36
34 0.41
35 0.43
36 0.42
37 0.42
38 0.43
39 0.43
40 0.42
41 0.46
42 0.48
43 0.49
44 0.5
45 0.58
46 0.61
47 0.66
48 0.7
49 0.72
50 0.72
51 0.76
52 0.8
53 0.75
54 0.76
55 0.71
56 0.64
57 0.59
58 0.57
59 0.53
60 0.49
61 0.47
62 0.39
63 0.37
64 0.36
65 0.32
66 0.29
67 0.24
68 0.23
69 0.23
70 0.25
71 0.28
72 0.36
73 0.38
74 0.43
75 0.49
76 0.53