Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6JZY0

Protein Details
Accession A0A5N6JZY0   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
56-78SSYSQHSNKHPNKLKRHINQNFGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6.5cyto_mito 6.5, extr 6, mito 5.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037944  PRX5-like  
IPR013740  Redoxin  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0008379  F:thioredoxin peroxidase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF08534  Redoxin  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03013  PRX5_like  
Amino Acid Sequences MRNGSFLTTIDESYLYMEACSGVGASWEGIYISKVKYPIDIFLFLFTSSTSTSTTSSYSQHSNKHPNKLKRHINQNFGWIPPTPENEDIKACGIPITYNASKEWANKKVVIFSLPGAFTPTCSASHLPGYIAKLPALREKGVDVVATIAYNDPFVMSAWGKANGIHNEDIVSSLHPSISQKPANLPTQLFLSDSDLSFSKLFGWTAGERTGRYALIIDNGKIVYAEIEPGREVTVSGADAVLSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.11
3 0.09
4 0.09
5 0.08
6 0.08
7 0.07
8 0.06
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.09
19 0.1
20 0.13
21 0.15
22 0.15
23 0.19
24 0.2
25 0.23
26 0.24
27 0.26
28 0.23
29 0.24
30 0.24
31 0.2
32 0.19
33 0.14
34 0.12
35 0.1
36 0.11
37 0.1
38 0.11
39 0.12
40 0.13
41 0.15
42 0.15
43 0.16
44 0.18
45 0.24
46 0.27
47 0.32
48 0.39
49 0.48
50 0.52
51 0.61
52 0.68
53 0.7
54 0.76
55 0.8
56 0.82
57 0.79
58 0.84
59 0.81
60 0.78
61 0.71
62 0.69
63 0.61
64 0.51
65 0.45
66 0.34
67 0.31
68 0.26
69 0.27
70 0.23
71 0.25
72 0.26
73 0.26
74 0.26
75 0.23
76 0.22
77 0.19
78 0.15
79 0.11
80 0.09
81 0.08
82 0.08
83 0.14
84 0.13
85 0.14
86 0.15
87 0.16
88 0.18
89 0.23
90 0.28
91 0.26
92 0.27
93 0.29
94 0.29
95 0.3
96 0.3
97 0.25
98 0.2
99 0.16
100 0.16
101 0.13
102 0.13
103 0.13
104 0.12
105 0.11
106 0.11
107 0.12
108 0.1
109 0.11
110 0.12
111 0.1
112 0.12
113 0.12
114 0.11
115 0.11
116 0.13
117 0.13
118 0.13
119 0.12
120 0.13
121 0.14
122 0.18
123 0.18
124 0.17
125 0.15
126 0.15
127 0.16
128 0.15
129 0.14
130 0.09
131 0.08
132 0.07
133 0.07
134 0.06
135 0.06
136 0.05
137 0.05
138 0.05
139 0.04
140 0.04
141 0.05
142 0.07
143 0.07
144 0.09
145 0.1
146 0.11
147 0.11
148 0.12
149 0.18
150 0.18
151 0.21
152 0.19
153 0.18
154 0.17
155 0.17
156 0.17
157 0.12
158 0.1
159 0.08
160 0.08
161 0.08
162 0.08
163 0.11
164 0.14
165 0.2
166 0.22
167 0.22
168 0.27
169 0.32
170 0.35
171 0.36
172 0.32
173 0.27
174 0.27
175 0.26
176 0.22
177 0.17
178 0.18
179 0.16
180 0.16
181 0.16
182 0.15
183 0.17
184 0.16
185 0.15
186 0.12
187 0.12
188 0.12
189 0.11
190 0.15
191 0.13
192 0.16
193 0.21
194 0.21
195 0.2
196 0.23
197 0.25
198 0.2
199 0.19
200 0.18
201 0.14
202 0.19
203 0.21
204 0.18
205 0.19
206 0.19
207 0.18
208 0.17
209 0.16
210 0.11
211 0.09
212 0.13
213 0.11
214 0.12
215 0.13
216 0.13
217 0.14
218 0.13
219 0.12
220 0.1
221 0.11
222 0.1
223 0.1
224 0.1
225 0.09