Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K5U4

Protein Details
Accession A0A5N6K5U4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-60QTIIQHQERRKKERREKEISHAANHydrophilic
NLS Segment(s)
PositionSequence
46-51RKKERR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQQQKASTASTNYHTPGILADTLIRSSLINHSQRNAQTIIQHQERRKKERREKEISHAANNPILTFTPLPQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.18
4 0.17
5 0.14
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.07
13 0.08
14 0.12
15 0.18
16 0.22
17 0.22
18 0.23
19 0.28
20 0.28
21 0.3
22 0.27
23 0.21
24 0.19
25 0.23
26 0.27
27 0.29
28 0.34
29 0.36
30 0.44
31 0.5
32 0.57
33 0.62
34 0.67
35 0.72
36 0.77
37 0.82
38 0.83
39 0.82
40 0.82
41 0.83
42 0.75
43 0.7
44 0.64
45 0.57
46 0.5
47 0.44
48 0.35
49 0.26
50 0.23
51 0.22
52 0.18