Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VE72

Protein Details
Accession H1VE72   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-133TTRFREHKISHRSKPKYHHSEFBasic
NLS Segment(s)
PositionSequence
26-34RRALRKALR
103-127GKILPRRKVTTRFREHKISHRSKPK
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLDKILARMWYERELPGDDECGGDRRRALRKALRKAGAPATTVGYEIKLALSSRPEWADWYRHVFMSGDRKEQIARFSQNKRPLKESQSKIPLRKTGFEGSQGKILPRRKVTTRFREHKISHRSKPKYHHSEFESRFKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.24
5 0.2
6 0.19
7 0.18
8 0.2
9 0.19
10 0.18
11 0.2
12 0.24
13 0.32
14 0.35
15 0.42
16 0.46
17 0.55
18 0.64
19 0.71
20 0.67
21 0.62
22 0.62
23 0.62
24 0.54
25 0.45
26 0.36
27 0.29
28 0.26
29 0.24
30 0.19
31 0.12
32 0.1
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.09
39 0.1
40 0.12
41 0.13
42 0.13
43 0.15
44 0.17
45 0.19
46 0.19
47 0.25
48 0.24
49 0.23
50 0.23
51 0.2
52 0.21
53 0.27
54 0.27
55 0.23
56 0.23
57 0.23
58 0.23
59 0.24
60 0.24
61 0.19
62 0.22
63 0.26
64 0.31
65 0.38
66 0.47
67 0.52
68 0.52
69 0.52
70 0.53
71 0.55
72 0.59
73 0.56
74 0.55
75 0.58
76 0.62
77 0.61
78 0.62
79 0.6
80 0.53
81 0.52
82 0.47
83 0.42
84 0.38
85 0.41
86 0.39
87 0.34
88 0.36
89 0.34
90 0.31
91 0.33
92 0.38
93 0.37
94 0.4
95 0.44
96 0.46
97 0.56
98 0.64
99 0.68
100 0.73
101 0.73
102 0.73
103 0.78
104 0.75
105 0.75
106 0.76
107 0.75
108 0.74
109 0.77
110 0.79
111 0.76
112 0.82
113 0.83
114 0.82
115 0.78
116 0.77
117 0.73
118 0.76
119 0.75