Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K9V5

Protein Details
Accession A0A5N6K9V5    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
212-238LSMESKKKTDAKKRKAREILDKHRKEEBasic
271-300RQLDRVIERRRKKVEGKEKKNMPRARRVVEBasic
NLS Segment(s)
PositionSequence
139-154KKAVSRRREVVPVKKR
208-248KRKLLSMESKKKTDAKKRKAREILDKHRKEEKQLVKEGKTP
252-254KKA
257-257K
276-297VIERRRKKVEGKEKKNMPRARR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MLSTKRKALDNGLQRRVRARREPSEEIEESSSDSAPSEIGNDDEQEESSSDSEVDEQQDAEPSESDEEVSNDAASISFGALAKAQATMTKPSRKDLKKSKNSSGDGWEDNEATERKAGKKDQRDFTRSSKNAPTEISSKKAVSRRREVVPVKKREIRDPRFEPTNGPVDQGKIERAYSFLDDYREDEMKELREAIKKTKDEDVKETLKRKLLSMESKKKTDAKKRKAREILDKHRKEEKQLVKEGKTPYYLKKAEQKKRVLLDTYGELKGRQLDRVIERRRKKVEGKEKKNMPRARRVVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.67
4 0.67
5 0.66
6 0.65
7 0.65
8 0.71
9 0.76
10 0.73
11 0.73
12 0.66
13 0.59
14 0.52
15 0.42
16 0.36
17 0.3
18 0.24
19 0.16
20 0.15
21 0.12
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.1
28 0.11
29 0.12
30 0.12
31 0.13
32 0.12
33 0.12
34 0.12
35 0.11
36 0.11
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.11
43 0.11
44 0.11
45 0.15
46 0.15
47 0.15
48 0.13
49 0.12
50 0.13
51 0.13
52 0.13
53 0.1
54 0.11
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.1
74 0.16
75 0.22
76 0.29
77 0.3
78 0.35
79 0.45
80 0.48
81 0.56
82 0.6
83 0.65
84 0.69
85 0.75
86 0.79
87 0.78
88 0.76
89 0.69
90 0.63
91 0.56
92 0.47
93 0.41
94 0.33
95 0.24
96 0.21
97 0.22
98 0.17
99 0.13
100 0.14
101 0.14
102 0.16
103 0.21
104 0.27
105 0.32
106 0.41
107 0.49
108 0.56
109 0.61
110 0.63
111 0.64
112 0.64
113 0.66
114 0.57
115 0.54
116 0.51
117 0.45
118 0.42
119 0.38
120 0.34
121 0.29
122 0.31
123 0.29
124 0.25
125 0.24
126 0.27
127 0.31
128 0.36
129 0.36
130 0.42
131 0.43
132 0.44
133 0.52
134 0.53
135 0.58
136 0.6
137 0.6
138 0.59
139 0.59
140 0.57
141 0.58
142 0.63
143 0.59
144 0.58
145 0.56
146 0.55
147 0.54
148 0.53
149 0.46
150 0.38
151 0.39
152 0.3
153 0.27
154 0.22
155 0.19
156 0.2
157 0.19
158 0.17
159 0.12
160 0.12
161 0.11
162 0.11
163 0.12
164 0.11
165 0.12
166 0.12
167 0.13
168 0.13
169 0.14
170 0.17
171 0.16
172 0.15
173 0.15
174 0.15
175 0.15
176 0.15
177 0.15
178 0.15
179 0.19
180 0.21
181 0.27
182 0.33
183 0.33
184 0.35
185 0.41
186 0.44
187 0.42
188 0.46
189 0.46
190 0.45
191 0.5
192 0.52
193 0.48
194 0.48
195 0.45
196 0.41
197 0.4
198 0.4
199 0.44
200 0.5
201 0.57
202 0.57
203 0.59
204 0.61
205 0.62
206 0.65
207 0.65
208 0.66
209 0.66
210 0.71
211 0.77
212 0.84
213 0.85
214 0.83
215 0.83
216 0.83
217 0.83
218 0.84
219 0.81
220 0.75
221 0.76
222 0.7
223 0.66
224 0.65
225 0.64
226 0.61
227 0.65
228 0.68
229 0.62
230 0.67
231 0.64
232 0.58
233 0.53
234 0.48
235 0.45
236 0.48
237 0.47
238 0.46
239 0.51
240 0.58
241 0.62
242 0.68
243 0.7
244 0.68
245 0.72
246 0.73
247 0.67
248 0.59
249 0.53
250 0.5
251 0.47
252 0.41
253 0.35
254 0.29
255 0.27
256 0.32
257 0.3
258 0.26
259 0.24
260 0.29
261 0.37
262 0.47
263 0.55
264 0.58
265 0.65
266 0.72
267 0.76
268 0.78
269 0.78
270 0.79
271 0.8
272 0.82
273 0.84
274 0.85
275 0.88
276 0.9
277 0.91
278 0.88
279 0.85
280 0.84