Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K5R0

Protein Details
Accession A0A5N6K5R0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-110ETGKDGRRGKSRRSKEHTSAHNYGBasic
NLS Segment(s)
PositionSequence
92-100GRRGKSRRS
Subcellular Location(s) mito 12, cyto_mito 10.333, cyto 6.5, cyto_nucl 5.166, extr 5
Family & Domain DBs
Amino Acid Sequences MSFYSRRWLCDLLRCDISSLPRVLDVFSAAIYSQVLKDFVEDTFPTTKGADICQKRSNALTYKRYGLSSFLWVSVESAHVIESKVIETGKDGRRGKSRRSKEHTSAHNYGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.37
4 0.36
5 0.32
6 0.29
7 0.23
8 0.2
9 0.2
10 0.19
11 0.17
12 0.14
13 0.1
14 0.09
15 0.09
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.1
28 0.1
29 0.12
30 0.14
31 0.14
32 0.14
33 0.14
34 0.15
35 0.12
36 0.14
37 0.2
38 0.21
39 0.25
40 0.28
41 0.29
42 0.28
43 0.29
44 0.31
45 0.3
46 0.34
47 0.34
48 0.32
49 0.35
50 0.36
51 0.35
52 0.32
53 0.27
54 0.22
55 0.21
56 0.19
57 0.16
58 0.15
59 0.15
60 0.14
61 0.12
62 0.11
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.1
75 0.18
76 0.23
77 0.32
78 0.34
79 0.38
80 0.48
81 0.54
82 0.62
83 0.65
84 0.69
85 0.71
86 0.77
87 0.81
88 0.8
89 0.84
90 0.83
91 0.82
92 0.76