Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K8Q7

Protein Details
Accession A0A5N6K8Q7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
183-208EPPQATPAPKRSHKKKDPNAHIPPVSHydrophilic
NLS Segment(s)
PositionSequence
169-198KRSHKRKEPIPPSVEPPQATPAPKRSHKKK
Subcellular Location(s) cyto 3, extr 5, mito 4, nucl 15
Family & Domain DBs
Amino Acid Sequences MNFGILEVALATGKAAPAPGWAYVPDVTNSTPQIGLQPSSRRARGLGPNAGSRNVAGTGFSAHETTKKQDAKILRELQLLDRENHRDVGIAVVGRSAREGRGTQKLTPAVRKILASQKTFANHLSDYEALASLPSTSNTTSSQQAQGGTPAVSSPQLAPPSAGLTSTGKRSHKRKEPIPPSVEPPQATPAPKRSHKKKDPNAHIPPVSTPLRQSSTPALKPDPAISTPSFTPSSPPLSPSQTPPSRQRPPAHFSRPRLALPGGNPKIIGYARVELQRGERRLDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.09
5 0.1
6 0.11
7 0.12
8 0.12
9 0.15
10 0.16
11 0.18
12 0.16
13 0.17
14 0.17
15 0.19
16 0.2
17 0.18
18 0.17
19 0.16
20 0.19
21 0.19
22 0.2
23 0.22
24 0.28
25 0.34
26 0.4
27 0.41
28 0.38
29 0.37
30 0.43
31 0.46
32 0.47
33 0.48
34 0.45
35 0.5
36 0.51
37 0.5
38 0.43
39 0.34
40 0.28
41 0.21
42 0.18
43 0.11
44 0.1
45 0.1
46 0.11
47 0.12
48 0.11
49 0.1
50 0.14
51 0.16
52 0.19
53 0.27
54 0.29
55 0.29
56 0.33
57 0.39
58 0.42
59 0.49
60 0.51
61 0.45
62 0.45
63 0.45
64 0.43
65 0.45
66 0.4
67 0.33
68 0.31
69 0.32
70 0.31
71 0.31
72 0.27
73 0.2
74 0.18
75 0.18
76 0.15
77 0.11
78 0.09
79 0.1
80 0.1
81 0.09
82 0.1
83 0.09
84 0.08
85 0.1
86 0.12
87 0.15
88 0.23
89 0.26
90 0.26
91 0.31
92 0.35
93 0.36
94 0.39
95 0.37
96 0.32
97 0.3
98 0.3
99 0.28
100 0.31
101 0.35
102 0.32
103 0.31
104 0.3
105 0.3
106 0.31
107 0.29
108 0.23
109 0.17
110 0.16
111 0.16
112 0.14
113 0.12
114 0.12
115 0.1
116 0.07
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.09
126 0.11
127 0.12
128 0.14
129 0.15
130 0.15
131 0.15
132 0.14
133 0.13
134 0.12
135 0.11
136 0.09
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.11
148 0.11
149 0.1
150 0.08
151 0.1
152 0.11
153 0.15
154 0.2
155 0.23
156 0.29
157 0.36
158 0.44
159 0.51
160 0.58
161 0.62
162 0.68
163 0.73
164 0.75
165 0.74
166 0.67
167 0.63
168 0.61
169 0.57
170 0.46
171 0.39
172 0.34
173 0.32
174 0.32
175 0.3
176 0.31
177 0.35
178 0.43
179 0.51
180 0.57
181 0.65
182 0.73
183 0.81
184 0.83
185 0.86
186 0.88
187 0.9
188 0.88
189 0.84
190 0.75
191 0.65
192 0.56
193 0.51
194 0.44
195 0.34
196 0.27
197 0.25
198 0.27
199 0.26
200 0.28
201 0.3
202 0.36
203 0.39
204 0.41
205 0.38
206 0.37
207 0.38
208 0.38
209 0.33
210 0.26
211 0.27
212 0.24
213 0.25
214 0.23
215 0.26
216 0.25
217 0.21
218 0.23
219 0.22
220 0.27
221 0.25
222 0.27
223 0.27
224 0.32
225 0.34
226 0.36
227 0.43
228 0.43
229 0.48
230 0.54
231 0.6
232 0.63
233 0.69
234 0.71
235 0.69
236 0.7
237 0.74
238 0.76
239 0.75
240 0.73
241 0.74
242 0.7
243 0.64
244 0.62
245 0.54
246 0.48
247 0.45
248 0.5
249 0.44
250 0.4
251 0.38
252 0.33
253 0.36
254 0.32
255 0.28
256 0.2
257 0.21
258 0.24
259 0.29
260 0.3
261 0.26
262 0.35
263 0.41
264 0.4