Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6K1Y5

Protein Details
Accession A0A5N6K1Y5   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-80THSGRIPQARKRRIKGHVTMHydrophilic
NLS Segment(s)
PositionSequence
70-73RKRR
Subcellular Location(s) cyto_nucl 8.833, mito 11.5, mito_nucl 12.666, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MRRSMRQRVLYSRHQTQLVTSYYESPHIWSGGFNLPIYITTYKSDFIPRGVSIAIKPKFQTHSGRIPQARKRRIKGHVTMIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.53
3 0.46
4 0.45
5 0.36
6 0.32
7 0.25
8 0.24
9 0.23
10 0.25
11 0.23
12 0.18
13 0.18
14 0.15
15 0.14
16 0.11
17 0.14
18 0.15
19 0.16
20 0.14
21 0.13
22 0.12
23 0.12
24 0.15
25 0.13
26 0.1
27 0.1
28 0.11
29 0.11
30 0.12
31 0.14
32 0.12
33 0.12
34 0.14
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.21
41 0.22
42 0.21
43 0.22
44 0.25
45 0.28
46 0.32
47 0.37
48 0.34
49 0.43
50 0.47
51 0.55
52 0.57
53 0.62
54 0.67
55 0.7
56 0.75
57 0.74
58 0.76
59 0.76
60 0.79
61 0.8
62 0.79