Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K166

Protein Details
Accession A0A5N6K166    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-81EVKYDKKYGHRKDYQEWKKNTBasic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010721  UstE-like  
Pfam View protein in Pfam  
PF06966  DUF1295  
Amino Acid Sequences MLWSGIAVLSAGVLAGREWVSWGWGLLDGGFGGGCWGGVAGVSPAFVTFLLLKVSGVPLSEVKYDKKYGHRKDYQEWKKNTPMFIPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.05
3 0.05
4 0.05
5 0.07
6 0.07
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.08
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.09
47 0.12
48 0.14
49 0.16
50 0.2
51 0.23
52 0.26
53 0.35
54 0.44
55 0.5
56 0.58
57 0.64
58 0.66
59 0.73
60 0.8
61 0.81
62 0.8
63 0.78
64 0.74
65 0.76
66 0.74
67 0.67
68 0.61