Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KN63

Protein Details
Accession A0A5N6KN63    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-45TSVYICTRLKRWQRNHKKIRSHRFCREFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, cyto 2
Family & Domain DBs
Amino Acid Sequences MCVEQEVRCTGCNESSTSVYICTRLKRWQRNHKKIRSHRFCREFSISRPRRQSSSAHIDCPIRPEEEQIEHQHEEECVYDYAFQCPSPIQTYPTPYPYPYPYPYSFYPSWCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.24
4 0.23
5 0.23
6 0.2
7 0.22
8 0.22
9 0.23
10 0.25
11 0.32
12 0.42
13 0.49
14 0.59
15 0.67
16 0.76
17 0.83
18 0.9
19 0.9
20 0.91
21 0.92
22 0.93
23 0.92
24 0.9
25 0.89
26 0.85
27 0.78
28 0.73
29 0.71
30 0.62
31 0.57
32 0.6
33 0.55
34 0.54
35 0.59
36 0.54
37 0.49
38 0.48
39 0.45
40 0.41
41 0.46
42 0.41
43 0.35
44 0.36
45 0.35
46 0.32
47 0.33
48 0.26
49 0.17
50 0.15
51 0.16
52 0.17
53 0.18
54 0.22
55 0.22
56 0.26
57 0.24
58 0.25
59 0.23
60 0.21
61 0.18
62 0.15
63 0.15
64 0.1
65 0.1
66 0.12
67 0.12
68 0.14
69 0.14
70 0.13
71 0.11
72 0.12
73 0.14
74 0.15
75 0.16
76 0.18
77 0.21
78 0.28
79 0.32
80 0.37
81 0.36
82 0.34
83 0.37
84 0.39
85 0.42
86 0.39
87 0.42
88 0.39
89 0.42
90 0.43
91 0.47
92 0.43