Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KEY8

Protein Details
Accession A0A5N6KEY8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-73MPCQRHRQANAKAKPKPKPSKPHRYYHydrophilic
NLS Segment(s)
PositionSequence
57-70NAKAKPKPKPSKPH
Subcellular Location(s) mito 22, nucl 2, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKSSESVLYARRDHPGRCARVASGGFFVVQGVYEGYIQMIRLLEVISMPCQRHRQANAKAKPKPKPSKPHRYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.46
4 0.46
5 0.46
6 0.39
7 0.42
8 0.41
9 0.33
10 0.26
11 0.21
12 0.18
13 0.16
14 0.15
15 0.08
16 0.07
17 0.06
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.05
27 0.04
28 0.04
29 0.05
30 0.04
31 0.05
32 0.06
33 0.08
34 0.11
35 0.12
36 0.16
37 0.2
38 0.22
39 0.29
40 0.35
41 0.42
42 0.49
43 0.59
44 0.65
45 0.7
46 0.76
47 0.77
48 0.8
49 0.81
50 0.82
51 0.81
52 0.84
53 0.85