Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6KB30

Protein Details
Accession A0A5N6KB30    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-71IRRPLPQHPKSLRRRHHYKRRSRLVSFTVBasic
NLS Segment(s)
PositionSequence
50-64HPKSLRRRHHYKRRS
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSAGPIEAAYLAYTTSRSSAGSSHILQTSEITTIPSDYIALTIRRPLPQHPKSLRRRHHYKRRSRLVSFTVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.09
6 0.1
7 0.13
8 0.16
9 0.17
10 0.18
11 0.19
12 0.19
13 0.19
14 0.18
15 0.16
16 0.12
17 0.11
18 0.09
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.07
27 0.07
28 0.07
29 0.11
30 0.13
31 0.15
32 0.17
33 0.23
34 0.32
35 0.36
36 0.46
37 0.51
38 0.59
39 0.67
40 0.76
41 0.79
42 0.78
43 0.85
44 0.86
45 0.88
46 0.89
47 0.9
48 0.9
49 0.92
50 0.91
51 0.85
52 0.83
53 0.77