Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6K8U2

Protein Details
Accession A0A5N6K8U2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-114EKEKEKEKEKEKEKEKRREEKKRKEKKRKEKKESRGLGFBasic
NLS Segment(s)
PositionSequence
59-111KEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKRREEKKRKEKKRKEKKESRG
Subcellular Location(s) nucl 13, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MGVDMRLNVKSVGLVYGMFGWMDGCYATRTNDNAVMFEQMMNDWIGFGWVGWNGWEMEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKRREEKKRKEKKRKEKKESRGLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.07
6 0.07
7 0.06
8 0.05
9 0.06
10 0.05
11 0.05
12 0.07
13 0.08
14 0.1
15 0.12
16 0.13
17 0.16
18 0.2
19 0.19
20 0.18
21 0.18
22 0.18
23 0.16
24 0.15
25 0.12
26 0.08
27 0.09
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.07
43 0.08
44 0.11
45 0.16
46 0.17
47 0.21
48 0.27
49 0.33
50 0.38
51 0.45
52 0.52
53 0.55
54 0.63
55 0.67
56 0.69
57 0.72
58 0.74
59 0.74
60 0.74
61 0.74
62 0.74
63 0.74
64 0.74
65 0.74
66 0.74
67 0.74
68 0.74
69 0.74
70 0.74
71 0.74
72 0.74
73 0.76
74 0.77
75 0.8
76 0.81
77 0.83
78 0.85
79 0.88
80 0.9
81 0.91
82 0.92
83 0.93
84 0.94
85 0.95
86 0.96
87 0.97
88 0.96
89 0.97
90 0.97
91 0.97
92 0.97
93 0.96
94 0.96