FuNGI

H1V484

Protein Details

Accession

H1V484

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
485-504	IEMKVGPKWRMKRDLKSVDD	Hydrophilic

NLS Segment(s)

Position	Sequence
259-272	RSRRKNRPAARSKA

Subcellular Location(s)

plas 21, E.R. 3, vacu 3

Family & Domain DBs

InterPro	View protein in InterPro IPR011701 MFS IPR020846 MFS_dom IPR036259 MFS_trans_sf
Gene Ontology	GO:0016020 C:membrane GO:0022857 F:transmembrane transporter activity
Pfam	View protein in Pfam PF07690 MFS_1
PROSITE	View protein in PROSITE PS50850 MFS

Amino Acid Sequences

MAEPKTECRNAGPGAGAASVSAPAPSPDPGPEPLTLPLGEAAPAEVYSIFTRKEKWFIVGMVAVAGPLPANIYLPAIPKLSEAFGHSVEDLNLTVTAFLAMQGISPMLWGPLSDRYGRRPVFLVCLTVLIGACAGIAVIPTNAFWLLIVLRCLQAAGCASTIALGAGVIGDISTPEERGGFFGMFNLGPMISPCIAPAIGGALSDQLGWRSIFWFLIIMAVCCLLFILLFLPETLRNLVGNGSVSLGGVYVPLLPVVGRSRRKNRPAARSKAGVRPSINPFVILVYPDVAITLTFTGIVYAVNNTVVTTIASSFARVYPWLXETALGLCYLPTGFGMIVGSTLTGKILDWDYARIKKRVEASDGACPFPKEYARMRTMPILLVLFSGAVIAWGFCVDNGVHIAVPLVIQVVLGYTSISILNTTMTLMIDILQTRSSSATACTNLVRCLLAALLVGLIDRMTSALRISWTYVLLGGVCALLLPLMYIEMKVGPKWRMKRDLKSVDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.24
3	0.2
4	0.14
5	0.13
6	0.11
7	0.09
8	0.08
9	0.07
10	0.07
11	0.09
12	0.11
13	0.12
14	0.14
15	0.17
16	0.2
17	0.23
18	0.23
19	0.24
20	0.24
21	0.26
22	0.23
23	0.2
24	0.18
25	0.16
26	0.15
27	0.12
28	0.11
29	0.09
30	0.09
31	0.09
32	0.07
33	0.09
34	0.11
35	0.13
36	0.15
37	0.16
38	0.21
39	0.24
40	0.3
41	0.3
42	0.32
43	0.33
44	0.31
45	0.33
46	0.29
47	0.26
48	0.2
49	0.18
50	0.14
51	0.1
52	0.09
53	0.06
54	0.04
55	0.05
56	0.04
57	0.05
58	0.06
59	0.08
60	0.1
61	0.12
62	0.15
63	0.15
64	0.15
65	0.15
66	0.16
67	0.16
68	0.15
69	0.15
70	0.16
71	0.16
72	0.17
73	0.17
74	0.16
75	0.15
76	0.15
77	0.12
78	0.1
79	0.09
80	0.08
81	0.07
82	0.06
83	0.07
84	0.06
85	0.06
86	0.05
87	0.05
88	0.05
89	0.05
90	0.05
91	0.05
92	0.05
93	0.05
94	0.04
95	0.05
96	0.04
97	0.06
98	0.12
99	0.14
100	0.19
101	0.21
102	0.26
103	0.36
104	0.36
105	0.36
106	0.33
107	0.32
108	0.34
109	0.33
110	0.3
111	0.21
112	0.21
113	0.19
114	0.17
115	0.16
116	0.09
117	0.08
118	0.05
119	0.05
120	0.04
121	0.03
122	0.02
123	0.02
124	0.03
125	0.03
126	0.03
127	0.04
128	0.05
129	0.05
130	0.05
131	0.05
132	0.05
133	0.06
134	0.07
135	0.08
136	0.08
137	0.09
138	0.09
139	0.09
140	0.08
141	0.08
142	0.08
143	0.08
144	0.08
145	0.07
146	0.07
147	0.07
148	0.08
149	0.06
150	0.05
151	0.03
152	0.03
153	0.03
154	0.03
155	0.02
156	0.02
157	0.02
158	0.02
159	0.04
160	0.04
161	0.05
162	0.05
163	0.06
164	0.06
165	0.07
166	0.09
167	0.08
168	0.07
169	0.08
170	0.09
171	0.08
172	0.08
173	0.08
174	0.06
175	0.05
176	0.06
177	0.08
178	0.07
179	0.07
180	0.07
181	0.07
182	0.07
183	0.07
184	0.07
185	0.06
186	0.05
187	0.05
188	0.05
189	0.05
190	0.05
191	0.05
192	0.05
193	0.04
194	0.05
195	0.06
196	0.06
197	0.06
198	0.07
199	0.07
200	0.07
201	0.07
202	0.05
203	0.08
204	0.08
205	0.07
206	0.07
207	0.07
208	0.06
209	0.06
210	0.06
211	0.03
212	0.03
213	0.03
214	0.03
215	0.03
216	0.03
217	0.04
218	0.05
219	0.05
220	0.06
221	0.07
222	0.07
223	0.06
224	0.06
225	0.07
226	0.07
227	0.07
228	0.06
229	0.06
230	0.06
231	0.06
232	0.05
233	0.05
234	0.04
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.03
242	0.04
243	0.07
244	0.14
245	0.19
246	0.26
247	0.35
248	0.44
249	0.5
250	0.59
251	0.64
252	0.68
253	0.73
254	0.74
255	0.7
256	0.68
257	0.65
258	0.63
259	0.59
260	0.52
261	0.44
262	0.41
263	0.42
264	0.41
265	0.37
266	0.3
267	0.26
268	0.22
269	0.21
270	0.16
271	0.11
272	0.07
273	0.07
274	0.07
275	0.06
276	0.05
277	0.05
278	0.05
279	0.05
280	0.04
281	0.04
282	0.04
283	0.04
284	0.04
285	0.04
286	0.04
287	0.04
288	0.05
289	0.05
290	0.05
291	0.05
292	0.05
293	0.05
294	0.05
295	0.05
296	0.05
297	0.06
298	0.06
299	0.07
300	0.08
301	0.08
302	0.09
303	0.09
304	0.09
305	0.09
306	0.1
307	0.11
308	0.1
309	0.1
310	0.1
311	0.1
312	0.1
313	0.08
314	0.06
315	0.06
316	0.06
317	0.06
318	0.05
319	0.05
320	0.04
321	0.04
322	0.05
323	0.04
324	0.05
325	0.04
326	0.05
327	0.04
328	0.04
329	0.04
330	0.04
331	0.04
332	0.06
333	0.07
334	0.08
335	0.09
336	0.13
337	0.18
338	0.25
339	0.29
340	0.31
341	0.31
342	0.33
343	0.4
344	0.4
345	0.4
346	0.39
347	0.38
348	0.44
349	0.45
350	0.42
351	0.36
352	0.32
353	0.27
354	0.25
355	0.24
356	0.19
357	0.24
358	0.31
359	0.34
360	0.36
361	0.37
362	0.39
363	0.38
364	0.34
365	0.3
366	0.22
367	0.17
368	0.15
369	0.13
370	0.08
371	0.07
372	0.06
373	0.04
374	0.04
375	0.04
376	0.03
377	0.03
378	0.04
379	0.04
380	0.04
381	0.06
382	0.05
383	0.06
384	0.08
385	0.09
386	0.08
387	0.08
388	0.09
389	0.07
390	0.07
391	0.06
392	0.05
393	0.04
394	0.04
395	0.04
396	0.04
397	0.04
398	0.04
399	0.04
400	0.04
401	0.05
402	0.05
403	0.06
404	0.06
405	0.05
406	0.06
407	0.06
408	0.07
409	0.07
410	0.06
411	0.06
412	0.06
413	0.07
414	0.08
415	0.09
416	0.1
417	0.1
418	0.1
419	0.11
420	0.12
421	0.12
422	0.11
423	0.12
424	0.16
425	0.17
426	0.19
427	0.21
428	0.22
429	0.23
430	0.24
431	0.22
432	0.17
433	0.15
434	0.13
435	0.1
436	0.08
437	0.07
438	0.06
439	0.05
440	0.05
441	0.05
442	0.04
443	0.04
444	0.04
445	0.04
446	0.05
447	0.05
448	0.06
449	0.08
450	0.1
451	0.12
452	0.15
453	0.16
454	0.16
455	0.16
456	0.16
457	0.14
458	0.13
459	0.12
460	0.09
461	0.07
462	0.06
463	0.05
464	0.05
465	0.04
466	0.03
467	0.03
468	0.03
469	0.05
470	0.05
471	0.06
472	0.07
473	0.11
474	0.12
475	0.15
476	0.21
477	0.26
478	0.35
479	0.44
480	0.52
481	0.59
482	0.67
483	0.74
484	0.79

H1V484

3D AlphaFold-predicted Structure Viewer