Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6KBD2

Protein Details
Accession A0A5N6KBD2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
145-165CEKATAKKRCHKSSVKNKATTHydrophilic
NLS Segment(s)
PositionSequence
160-174KNKATTGKGKVLKTK
Subcellular Location(s) cyto 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSETFKLTPADANLLWAIFAVVPRRELSKMVDWKVVGTKLGGLNQKAVTKRWSRLNIKMREDSDDGDIGEVDTGATQEILSGGESGNDGQKVDTEETSGGKTSAKKRTRIAPVKPTTGTGITEDVASDDGAGTGGQIITIKETACEKATAKKRCHKSSVKNKATTGKGKVLKTKATWKSVKAEVAAEAKGKEKGTQEGFDSED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.14
4 0.13
5 0.08
6 0.1
7 0.12
8 0.13
9 0.15
10 0.16
11 0.19
12 0.2
13 0.21
14 0.25
15 0.3
16 0.37
17 0.38
18 0.41
19 0.38
20 0.39
21 0.42
22 0.37
23 0.28
24 0.2
25 0.21
26 0.19
27 0.24
28 0.26
29 0.23
30 0.25
31 0.27
32 0.32
33 0.3
34 0.3
35 0.31
36 0.33
37 0.37
38 0.43
39 0.49
40 0.51
41 0.59
42 0.67
43 0.68
44 0.69
45 0.7
46 0.62
47 0.58
48 0.54
49 0.45
50 0.38
51 0.3
52 0.23
53 0.17
54 0.16
55 0.1
56 0.09
57 0.07
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.09
79 0.1
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.1
86 0.08
87 0.09
88 0.13
89 0.18
90 0.28
91 0.32
92 0.35
93 0.38
94 0.46
95 0.55
96 0.59
97 0.59
98 0.6
99 0.6
100 0.6
101 0.57
102 0.5
103 0.42
104 0.35
105 0.28
106 0.19
107 0.16
108 0.12
109 0.11
110 0.1
111 0.08
112 0.08
113 0.07
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.06
127 0.06
128 0.07
129 0.09
130 0.1
131 0.11
132 0.13
133 0.13
134 0.22
135 0.31
136 0.38
137 0.45
138 0.52
139 0.61
140 0.66
141 0.74
142 0.75
143 0.77
144 0.8
145 0.84
146 0.84
147 0.8
148 0.77
149 0.76
150 0.73
151 0.69
152 0.64
153 0.62
154 0.59
155 0.58
156 0.62
157 0.59
158 0.58
159 0.56
160 0.61
161 0.59
162 0.61
163 0.61
164 0.57
165 0.58
166 0.57
167 0.56
168 0.47
169 0.41
170 0.36
171 0.35
172 0.33
173 0.29
174 0.24
175 0.23
176 0.25
177 0.25
178 0.24
179 0.24
180 0.3
181 0.33
182 0.35
183 0.36